DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4884 and mtres1

DIOPT Version :9

Sequence 1:NP_001287572.1 Gene:CG4884 / 43357 FlyBaseID:FBgn0039565 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001139062.1 Gene:mtres1 / 565648 ZFINID:ZDB-GENE-030131-2912 Length:222 Species:Danio rerio


Alignment Length:206 Identity:64/206 - (31%)
Similarity:98/206 - (47%) Gaps:46/206 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RQIARLGR-SLRTPFPSKSL----PKLSTTLEL----QAPVHTSA---------SAWKYD----- 47
            ||:.||.. .|.||.....|    |::....:|    .:..|.:|         .:|...     
Zfish    12 RQLGRLNSLQLLTPCHGSGLSMWCPRMLHARQLWGSATSQTHRTAMGPKSWDARQSWTLHQIRLK 76

  Fly    48 ---KKSSRASDDLDSDDEDDEDFKDE-----------RDSKVVKTKVNSLRADLLLKAGLGMARN 98
               ||..:.:...:..:|:..|::||           :|::.|   |.|||.||:||:||.:||:
Zfish    77 STRKKGKQKAVHQEETEEETSDYEDEFPDDPGLPNNYKDNEKV---VQSLRFDLVLKSGLDIARH 138

  Fly    99 KVELNFYESKIRVNGKKLPKKSAQLEVGDEIDVIRGFSQSNPSHLVVARVSILS--VSEREEG-- 159
            .||.:||..|:|:||:||.||...::|||.:|.|  .|.......::.:..||.  |||.::|  
Zfish   139 SVEDSFYSLKLRLNGQKLSKKGKLVKVGDTLDQI--LSDDKERDTILLKRVILKKVVSETKDGEK 201

  Fly   160 LSVHLRRYKSL 170
            |.|.||.:|||
Zfish   202 LKVILRSWKSL 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4884NP_001287572.1 YlmH <73..168 CDD:225185 41/98 (42%)
mtres1NP_001139062.1 YlmH <99..207 CDD:225185 42/112 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594966
Domainoid 1 1.000 71 1.000 Domainoid score I9352
eggNOG 1 0.900 - - E1_COG2302
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5295
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007897
OrthoInspector 1 1.000 - - oto40832
orthoMCL 1 0.900 - - OOG6_109683
Panther 1 1.100 - - LDO PTHR13633
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6945
SonicParanoid 1 1.000 - - X5848
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.780

Return to query results.
Submit another query.