DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4884 and MTRES1

DIOPT Version :9

Sequence 1:NP_001287572.1 Gene:CG4884 / 43357 FlyBaseID:FBgn0039565 Length:189 Species:Drosophila melanogaster
Sequence 2:XP_016866409.1 Gene:MTRES1 / 51250 HGNCID:17971 Length:270 Species:Homo sapiens


Alignment Length:187 Identity:62/187 - (33%)
Similarity:94/187 - (50%) Gaps:37/187 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SLRTP---------FPSKSLPKLSTTLELQAPVHTSASAWKYDKKSSRASDDLDSDDEDDEDFKD 69
            |||.|         ||        .::.|::.:.::.|.    |||.:..|:.|||:|...|...
Human    94 SLRLPGLLLSPECIFP--------FSVRLKSNIRSTKST----KKSLQKVDEEDSDEESHHDEMS 146

  Fly    70 ER------DSKVVKT------KVNSLRADLLLKAGLGMARNKVELNFYESKIRVNGKKLPKKSAQ 122
            |:      |..|||.      .|.|.|.|::||.||.:.|||||..||:.::|:|.:||.|||..
Human   147 EQEEELEDDPTVVKNYKDLEKAVQSFRYDVVLKTGLDIGRNKVEDAFYKGELRLNEEKLWKKSRT 211

  Fly   123 LEVGDEIDVIRGFSQSNPSHLVVARVSILSVSERE---EGLSVHLRRYKSLLVENYR 176
            ::|||.:|::.|..:...:..|: |:.:..|.|.:   |...|.|||:|||.:...|
Human   212 VKVGDTLDLLIGEDKEAGTETVM-RILLKKVFEEKTESEKYRVVLRRWKSLKLPKKR 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4884NP_001287572.1 YlmH <73..168 CDD:225185 39/103 (38%)
MTRES1XP_016866409.1 PS_II_S4 <171..257 CDD:132113 33/86 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158989
Domainoid 1 1.000 73 1.000 Domainoid score I9242
eggNOG 1 0.900 - - E1_COG2302
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5289
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007897
OrthoInspector 1 1.000 - - oto91223
orthoMCL 1 0.900 - - OOG6_109683
Panther 1 1.100 - - LDO PTHR13633
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6945
SonicParanoid 1 1.000 - - X5848
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.820

Return to query results.
Submit another query.