DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4884 and C47B2.9

DIOPT Version :9

Sequence 1:NP_001287572.1 Gene:CG4884 / 43357 FlyBaseID:FBgn0039565 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_493277.2 Gene:C47B2.9 / 173173 WormBaseID:WBGene00008134 Length:153 Species:Caenorhabditis elegans


Alignment Length:182 Identity:46/182 - (25%)
Similarity:79/182 - (43%) Gaps:39/182 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLRTFRQIARLGRSLRTPFPSKSLPKLSTTLELQAPVHTSASAWKYDKK----SSRASDDLD-SD 60
            ||...|.|:|     ||         |:||..|            ::||    |||....:| .|
 Worm     1 MLTAVRPISR-----RT---------LTTTSAL------------FNKKKPTSSSRGGSHVDVGD 39

  Fly    61 DEDDEDFKDERDSKVVKT-KVNSLRADLLLKAGLGMARNKVELNFYESKIRVNGKKLPKKSAQLE 124
            |...:|:|       :|| :..|.|.|..:....|.:.::|.....:.|:|||.:...||:..:.
 Worm    40 DGLPKDYK-------LKTLRAGSRRLDTFVNRATGQSSSEVVKLIMQGKVRVNEEVYTKKAYNVC 97

  Fly   125 VGDEIDVIRGFSQSNPSHLVVARVSILSVSEREEGLSVHLRRYKSLLVENYR 176
            ..|.:::.:.....|.:...|.|..|:|....|:|.::.::.:|:.|.:|:|
 Worm    98 QEDVVEIWKSPFADNAALANVERTEIVSYEVTEQGYNIEVKSWKNFLSDNWR 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4884NP_001287572.1 YlmH <73..168 CDD:225185 21/95 (22%)
C47B2.9NP_493277.2 S4 56..102 CDD:366667 11/45 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166528
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109683
Panther 1 1.100 - - LDO PTHR13633
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.