DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mfrn and AT1G07025

DIOPT Version :9

Sequence 1:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_563776.1 Gene:AT1G07025 / 837213 AraportID:AT1G07025 Length:166 Species:Arabidopsis thaliana


Alignment Length:149 Identity:47/149 - (31%)
Similarity:75/149 - (50%) Gaps:9/149 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 MTAGAIAGVLEHVVMYPLDSVKTRMQSLSPPTKNMNIVSTLRTMITREGLLRPIRGASAVVLGA- 81
            |.||::||..:::.|:|:.::..||...|...:::.|...||::|..||.....||...:..|| 
plant    22 MIAGSVAGSFKNMTMFPVRTLDQRMLHRSYSQRHVGIRQALRSVIQTEGPSALYRGIWYMRHGAM 86

  Fly    82 GPAHSLYFAAYEMTKELTAKFTSVRNLN----YVISGAVATLIHDAISSPTDVIKQRMQMYNSPY 142
            |||..::|:.|:::|    .|.|..|.|    :|||.|...:...|:|:|.|:.|.|.|.....|
plant    87 GPAQFVHFSFYDVSK----NFLSTGNPNNPVVHVISWAFTAVWSYAVSTPVDMAKLRHQNGFGNY 147

  Fly   143 TSVVSCVRDIYKREGFKAF 161
            ..|..|.:.:...||...|
plant   148 KGVWDCAKRVTHEEGISKF 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578 26/80 (33%)
PTZ00168 17..280 CDD:185494 47/149 (32%)
Mito_carr 107..190 CDD:278578 19/59 (32%)
Mito_carr <215..282 CDD:278578
AT1G07025NP_563776.1 Mito_carr 14..108 CDD:278578 28/89 (31%)
Mito_carr 108..>166 CDD:278578 18/57 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 79 1.000 Domainoid score I3021
eggNOG 1 0.900 - - E1_KOG0760
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001524
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.