DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mfrn and NS2

DIOPT Version :9

Sequence 1:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_187398.1 Gene:NS2 / 819930 AraportID:AT3G07420 Length:638 Species:Arabidopsis thaliana


Alignment Length:330 Identity:60/330 - (18%)
Similarity:102/330 - (30%) Gaps:122/330 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 MNIVSTLRTMITREGLLRPI------RGASAVVLGAGPAHSLYFAAYEMTKELTAKFTSVRNLNY 110
            |||......:::..|...||      .|..||   ..|.:..||        |.:..:|:.:|..
plant   102 MNIFKRFFDVLSGGGKTYPIFDKTELAGQKAV---PPPEYVFYF--------LISDGSSISSLQV 155

  Fly   111 VISGAVATLIHDAISSPTDVIKQRMQMYNSPYTSVV---SCVRDIYKREGFKAFYRAYGTQLVMN 172
            |:..|::|:                     |.|.::   :|:    ..||......|...:.|:.
plant   156 VVDSALSTV---------------------PATQLMALGTCI----VAEGVLRLPLAASAKHVIE 195

  Fly   173 LPYQ-TIHFTTYEFFQNKMNLERKYNPPVHMAAGAAAGACAAAVTTPLDVIKTLLNTQETGLTRG 236
            |..: .:|..|.:  ..|..|.:|..|                                      
plant   196 LEAEKLLHVGTVD--PEKYPLSKKQLP-------------------------------------- 220

  Fly   237 MIEASRKIYHMAGPLGFFR------GTTARVLYSMPATAICWSTYEFFKFYLCGLDADQYK--SS 293
                    .||......||      |:..||     .:|:..:::.|.:::  |....|..  ::
plant   221 --------LHMLRDFSHFRPRTTTVGSVTRV-----HSALTLASHTFLQYH--GFQYVQVPVITT 270

  Fly   294 ITGSSEPRKADYVLPRTTDEEQ------------IDQEREAAKEKDTTATLHSAPTSVNASGAIK 346
            .||..|..:...:|.:|.|:|:            ||..:...||| |....|...:..|....:.
plant   271 TTGFGEMFRVTTLLGKTDDKEEKKPPVQEKDGFSIDTVKAVIKEK-TRLIDHLKRSDSNRETVVA 334

  Fly   347 TVCEL 351
            .|.:|
plant   335 AVHDL 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578 12/51 (24%)
PTZ00168 17..280 CDD:185494 41/243 (17%)
Mito_carr 107..190 CDD:278578 14/86 (16%)
Mito_carr <215..282 CDD:278578 9/72 (13%)
NS2NP_187398.1 PLN02532 1..638 CDD:215291 60/330 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1056670at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.