DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mfrn and NARS2

DIOPT Version :9

Sequence 1:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_078954.4 Gene:NARS2 / 79731 HGNCID:26274 Length:477 Species:Homo sapiens


Alignment Length:109 Identity:23/109 - (21%)
Similarity:45/109 - (41%) Gaps:17/109 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LSPPTKNMNIVSTLRTMITREGLLRPIRGASAVVLGAGPAHSLYFAAYEMTKELTAKFTSVRNLN 109
            |..|.:|...|....| ::.:..|..:.||...|...||.   :.|....::...|:|       
Human   203 LKVPEENFFNVPAFLT-VSGQLHLEVMSGAFTQVFTFGPT---FRAENSQSRRHLAEF------- 256

  Fly   110 YVISGAVATLIHDAISSPTDVIKQRMQMYNSPYTSVVS-CVRDI 152
            |:|...::.:  |::.....||:   :::.:....|:| |..|:
Human   257 YMIEAEISFV--DSLQDLMQVIE---ELFKATTMMVLSKCPEDV 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578 12/52 (23%)
PTZ00168 17..280 CDD:185494 23/109 (21%)
Mito_carr 107..190 CDD:278578 9/47 (19%)
Mito_carr <215..282 CDD:278578
NARS2NP_078954.4 asnC 27..474 CDD:235176 23/109 (21%)
EcAsnRS_like_N 44..120 CDD:239813
AsxRS_core 133..473 CDD:238399 23/109 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1056670at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.