DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mfrn and nars2

DIOPT Version :9

Sequence 1:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster
Sequence 2:XP_021337111.1 Gene:nars2 / 561673 ZFINID:ZDB-GENE-060929-596 Length:505 Species:Danio rerio


Alignment Length:162 Identity:29/162 - (17%)
Similarity:54/162 - (33%) Gaps:52/162 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 REGLLRPIRGASAVVLGAGPAHSLYFAAYEMTKELTAKFTSVRNLNYVISGAVATLIHDAISSPT 128
            |:.:..|:...|||.. .||.   :.|....::...|:|       |::...:|     ...|..
Zfish   250 RKDMHDPLSAFSAVYT-FGPT---FRAENSQSRRHLAEF-------YMVEAEIA-----FTESLD 298

  Fly   129 DVIKQRMQMYNSPYTSVVS-CVRDIYKREGFKAFYRAYGTQLVMNLPYQTIHFTTYEFFQNKMNL 192
            |::|....::.:....|.| |..|:      :.|::               |.......|....|
Zfish   299 DLMKVMEDLFKAATEHVFSNCTEDV------ELFHK---------------HVAPGHREQVDPML 342

  Fly   193 ERKYNPPVHMAAGAAAGACAAAVTTPLDVIKT 224
            .||:|              ..:.|..:|::|:
Zfish   343 NRKFN--------------VISYTEAIDILKS 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578 8/33 (24%)
PTZ00168 17..280 CDD:185494 29/162 (18%)
Mito_carr 107..190 CDD:278578 12/83 (14%)
Mito_carr <215..282 CDD:278578 3/10 (30%)
nars2XP_021337111.1 asnC 34..502 CDD:235176 29/162 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1056670at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.