DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mfrn and SLC25A38

DIOPT Version :10

Sequence 1:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_060345.2 Gene:SLC25A38 / 54977 HGNCID:26054 Length:304 Species:Homo sapiens


Alignment Length:246 Identity:55/246 - (22%)
Similarity:82/246 - (33%) Gaps:76/246 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MENILEP------SSSDDNMPSDNKKDLQSLLSSEDDFFDPPPSSSRRDSSGNEDKPDLRTDFED 59
            :.||||.      |..|..:....|.|...||||..:.|.            |::......|..|
Human   386 INNILEDRLAPELSQLDRGLERQVKPDPTPLLSSRHNIFQ------------NDEFDVFSRDSVD 438

  Fly    60 IIMPEMG---HDNSILMVKDQKDRERDKRKETKSKRELEEEEREKMQVLVSNFTEEQLDRY---- 117
            :.....|   .:|...:|.|::......::..|....:||...:..:....::.:|..|.|    
Human   439 LSRVHKGRRKEENVRSLVNDKQAVVAQWQRYQKYSVVVEEVPLQPGEYQADDYEDEYDDTYDGNQ 503

  Fly   118 ----------EMYRRAAFPKAAVKRLMQTITGCSVSQNVVIAMSGIAKVFVGEVVEEALDVMEKA 172
                      |:..|..|   .:.::::|                   ...|||.||..|..::.
Human   504 VGANDADSDDELISRRPF---TIPQVLRT-------------------KMPGEVQEEEWDEEDEV 546

  Fly   173 GETGA-----IQ-PKYLRE--AVRR---LRNKGHIP------TG--RGHKQ 204
            .|...     || |..|||  ..||   |..||:.|      ||  |||.|
Human   547 EEEAPKPDHFIQDPAVLREKAEARRMAFLARKGYRPENSTAVTGGPRGHGQ 597

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mfrnNP_651600.1 PTZ00168 17..280 CDD:185494 49/224 (22%)
SLC25A38NP_060345.2 Solcar 1. /evidence=ECO:0000255|HAMAP-Rule:MF_03064 25..114
Mito_carr 26..117 CDD:395101
Mito_carr 120..209 CDD:395101
Solcar 2. /evidence=ECO:0000255|HAMAP-Rule:MF_03064 121..205
Solcar 3. /evidence=ECO:0000255|HAMAP-Rule:MF_03064 215..299
Mito_carr 217..304 CDD:395101
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.