DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mfrn and CG7943

DIOPT Version :9

Sequence 1:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster


Alignment Length:220 Identity:53/220 - (24%)
Similarity:87/220 - (39%) Gaps:39/220 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IDDYESLPTTSVGVNMTAGAIAGVLEHVVMYPLDSVKTRMQSLSPPTKNMNIVSTLRTMITREGL 67
            ::||.   ....|..:.|..:||..|.::: |.:.|:|.:..........|..:..|.:::..|.
  Fly   133 VEDYR---LNDYGAKVLAAVVAGSAESILL-PFERVQTLLADSKFHQHFSNTQNAFRYVVSHHGY 193

  Fly    68 LRPIRGASAVVLGAGPAHSLYF-----AAYEMTKELTAKFTSVRNLNYVISGAVATLIHDAISSP 127
            ....||...|....|.:::|:|     |:..:.|.   |..|.|.:...|:|||.......|..|
  Fly   194 RELYRGLEPVFWRNGLSNALFFVLREEASVRLPKR---KSVSTRTVQEFIAGAVIGASISTIFYP 255

  Fly   128 TDVIKQRMQ--MYNSPYTSVVSCVRDIYKRE-GFKAFYRAYGTQLVMNLPYQT--------IHFT 181
            .:|||..:|  |......|..:|.|...:|: ....|||        ..|:.|        |..|
  Fly   256 LNVIKVSLQSEMGQRSEGSWQACKRIYVERDRRIGNFYR--------GCPFNTGRSFISWGIMNT 312

  Fly   182 TYEFFQNKMNLER--KYNPPVHMAA 204
            .||      ||::  :..||:.:|:
  Fly   313 AYE------NLKKLMQQQPPLPLAS 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578 19/89 (21%)
PTZ00168 17..280 CDD:185494 50/206 (24%)
Mito_carr 107..190 CDD:278578 24/93 (26%)
Mito_carr <215..282 CDD:278578
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 0/2 (0%)
Mito_carr 141..229 CDD:278578 19/91 (21%)
Mito_carr 235..322 CDD:278578 26/100 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441239
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.