DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mfrn and CG4743

DIOPT Version :9

Sequence 1:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster


Alignment Length:284 Identity:81/284 - (28%)
Similarity:130/284 - (45%) Gaps:51/284 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 MTAGAIAGVLEHVVMYPLDSVKTRMQSLSPPTKNMNIVSTLRTMITREGLLRPI-RGASAVVLGA 81
            :.||.:||::..:.::|:|:||||:||              .....|.|..|.| :|.:....|:
  Fly    31 LVAGGVAGMVVDIALFPIDTVKTRLQS--------------ELGFWRAGGFRGIYKGLAPAAAGS 81

  Fly    82 GPAHSLYFAAYEMTKELTAKFTSVRNLNYV--ISGAVATLIHDAISSPTDVIKQRMQMYNSPYTS 144
            .|..:|:|..||..|:..:..|..::..||  .:.:.|.::...|..|.::.|||.|.......|
  Fly    82 APTAALFFCTYECGKQFLSSVTQTKDSPYVHMAAASAAEVLACLIRVPVEIAKQRSQTLQGNKQS 146

  Fly   145 VVSCVRDIYKREGFK-AFYRAYGTQLVMNLPYQTIHFTTYEFFQNKMNLERKYNP-------PVH 201
            .:..:...|:.||.| ..||.:|:.::..:|:..|.|..:|:|      :.::.|       |..
  Fly   147 GLQILLRAYRTEGLKRGLYRGFGSTIMREIPFSLIQFPLWEYF------KLQWTPLTGFDSTPFS 205

  Fly   202 MA-AGAAAGACAAAVTTPLDVIKT-LLNTQETGLTRGMIEASRKIYH----MAGPLGFFRGTTAR 260
            :| .||.||..:|.:||||||:|| ::..:...|.|.  .::|:|.|    ..|..|.|.|...|
  Fly   206 VALCGAVAGGISAGLTTPLDVVKTRIMLAERESLNRR--RSARRILHGIYLERGFSGLFAGFVPR 268

  Fly   261 VLYSMPATAICWSTYE---FFKFY 281
            ||         |.|..   ||.||
  Fly   269 VL---------WITLGGAFFFGFY 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578 24/80 (30%)
PTZ00168 17..280 CDD:185494 79/281 (28%)
Mito_carr 107..190 CDD:278578 22/85 (26%)
Mito_carr <215..282 CDD:278578 26/75 (35%)
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 24/81 (30%)
PTZ00168 25..281 CDD:185494 78/280 (28%)
Mito_carr 199..291 CDD:278578 33/96 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441236
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.