DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mfrn and Tpc1

DIOPT Version :9

Sequence 1:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster


Alignment Length:223 Identity:64/223 - (28%)
Similarity:101/223 - (45%) Gaps:40/223 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 TKELTAKFTSV--------RNLNYVISGAVATLIHDAISSPTDVIKQRMQMYNSP---------- 141
            |.|.|...|.|        ..|:.:::|.::..|..:...|.||:|.|.|:...|          
  Fly     8 TSEATTTTTPVPRRKHSTREQLHQMLAGGLSAAITRSTCQPLDVLKIRFQLQVEPLGKNAAKEGP 72

  Fly   142 ------YTSVVSCVRDIYKREGFKAFYRAYGTQLVMNLPYQTIHFTTYEFFQNKMNLERKYNPPV 200
                  |||:...|:.||:.||..||::.:....|:::.|....|.|||    :::|..|....:
  Fly    73 GALTSKYTSIGQAVKTIYREEGMLAFWKGHNPAQVLSIMYGICQFWTYE----QLSLMAKQTSYL 133

  Fly   201 ----HMA---AGAAAGACAAAVTTPLDVIKTLLNTQETGLTRGMIEASR---KIYHMAGPLGFFR 255
                |::   .|||||..|..::||||||:|.|..|:|  ::|...|:|   .|....||.|.:|
  Fly   134 ADHQHLSNFLCGAAAGGAAVIISTPLDVIRTRLIAQDT--SKGYRNATRAVSAIVRQEGPRGMYR 196

  Fly   256 GTTARVLYSMPATAICWSTYEFFKFYLC 283
            |.::.:|...|.....:..|..|..:.|
  Fly   197 GLSSALLQITPLMGTNFMAYRLFSDWAC 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578 1/2 (50%)
PTZ00168 17..280 CDD:185494 63/218 (29%)
Mito_carr 107..190 CDD:278578 26/98 (27%)
Mito_carr <215..282 CDD:278578 23/69 (33%)
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 26/97 (27%)
PTZ00169 33..329 CDD:240302 58/198 (29%)
Mito_carr 153..222 CDD:278578 23/70 (33%)
Mito_carr 233..328 CDD:278578
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441219
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.