DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mfrn and Dic4

DIOPT Version :9

Sequence 1:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster


Alignment Length:287 Identity:79/287 - (27%)
Similarity:128/287 - (44%) Gaps:28/287 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GAIAGVLEHVVMYPLDSVKTRMQSLSPPTKNMNIVSTLRTMITREGLLRPIRGASAVVLGAGPAH 85
            |..|.:.....:.|:|.|||.||.   ..:..:|:.|::.:.:.:|.|....|.||.:|....:.
  Fly    26 GGFASMCVAFAVAPIDIVKTHMQI---QRQKRSILGTVKRIHSLKGYLGFYDGFSAAILRQMTST 87

  Fly    86 SLYFAAYEMTKELTAKFTSVRNLNY---VISGAVATLIHDAISSPTDVIKQRMQ--MYNSP---- 141
            :::|..|:..|    |...|...:|   :|.|.||.....|...|||:|..|||  |...|    
  Fly    88 NIHFIVYDTGK----KMEYVDRDSYLGKIILGCVAGACGSAFGIPTDLINVRMQTDMKEPPYKRR 148

  Fly   142 -YTSVVSCVRDIYKREGFKAFYRAYGTQLVMNLPYQTI-HFTTYEFFQNKM--NLERKYNPPVHM 202
             |..|...:..|.|.||:||.|:. |:..|......|. ....|:..:.::  |:......|:|.
  Fly   149 NYKHVFDGLIRIPKEEGWKALYKG-GSVAVFKSSLSTCSQIAFYDIIKTEVRKNISVNDGLPLHF 212

  Fly   203 AAGAAAGACAAAVTTPLDVIKTLLNTQETGLTRGMIEASRKIYHMA--GPLGFFRGTTARVLYSM 265
            .........::|:|.||||::|::.....|..|.:.:||   .||.  |.:|.:||....::...
  Fly   213 LTSLGTSIISSAITHPLDVVRTIMMNSRPGEFRTVFQAS---VHMMRFGVMGPYRGFVPTIVRKA 274

  Fly   266 PATAICWSTYEFFK--FYLCGLDADQY 290
            |||.:.:..||..:  |.:|.|..::|
  Fly   275 PATTLLFVLYEQLRLHFGICSLGGEKY 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578 20/76 (26%)
PTZ00168 17..280 CDD:185494 75/275 (27%)
Mito_carr 107..190 CDD:278578 28/93 (30%)
Mito_carr <215..282 CDD:278578 22/70 (31%)
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 75/272 (28%)
Mito_carr 26..100 CDD:278578 20/80 (25%)
Mito_carr 104..201 CDD:278578 28/97 (29%)
Mito_carr 211..292 CDD:278578 23/83 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441232
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.