DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mfrn and SCaMC

DIOPT Version :9

Sequence 1:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster


Alignment Length:321 Identity:87/321 - (27%)
Similarity:127/321 - (39%) Gaps:60/321 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNIDDYESLPTTSVGV---NMTAGAIAGVLEHVVMYPLDSVKTRMQSLSPPTKNMNIVSTLRTMI 62
            ||:.|..:......|:   ::.||.|||.:......|||.:|..:|   ..|:.|.|...:..|:
  Fly   269 MNVPDDFTQKEMQTGLWWRHLVAGGIAGAVSRTCTAPLDRIKVYLQ---VQTQRMGISECMHIML 330

  Fly    63 TREGLLRPIRGASAVVLGAGPAHSLYFAAYEMTKELTAKFTSVRNLNYV---ISGAVATLIHDAI 124
            ...|.....||....||...|..:..|||||..|.|.......|.::.|   .:||.|..|...|
  Fly   331 NEGGSRSMWRGNGINVLKIAPETAFKFAAYEQMKRLIRGDDGSRQMSIVERFYAGAAAGGISQTI 395

  Fly   125 SSPTDVIKQRMQMYNS-PYTSVVSCVRDIYKREGFKAFYRAYGTQLVMNLPYQTIHFTTYEFFQN 188
            ..|.:|:|.|:.:..: .|..:......|||:||.::|||.|...::..|||..|....||    
  Fly   396 IYPMEVLKTRLALRRTGQYAGIADAAVKIYKQEGVRSFYRGYVPNILGILPYAGIDLAVYE---- 456

  Fly   189 KMNLERKY--------NPP--VHMAAGAAAGACAAAVTTPLDVIKTLLNTQE------------- 230
              .|:|:|        .|.  |.:|.|:.:.......:.||.:::|.|..|.             
  Fly   457 --TLKRRYIANHDNNEQPSFLVLLACGSTSSTLGQLCSYPLALVRTRLQAQAAETIANQKRKTQI 519

  Fly   231 --------------TGLTRGMIEASRKIYHMAGPLGFFRGTTARVLYSMPATAICWSTYEF 277
                          |||       .|||....|..|.:||.|...|..:||.:|.:..||:
  Fly   520 PLKSSDAHSGEETMTGL-------FRKIVRQEGLTGLYRGITPNFLKVLPAVSISYVVYEY 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578 27/87 (31%)
PTZ00168 17..280 CDD:185494 83/302 (27%)
Mito_carr 107..190 CDD:278578 26/86 (30%)
Mito_carr <215..282 CDD:278578 22/90 (24%)
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 27/87 (31%)
Mito_carr 375..463 CDD:278578 28/93 (30%)
Mito_carr 470..581 CDD:278578 26/111 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441251
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.