DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mfrn and Shawn

DIOPT Version :9

Sequence 1:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001027071.1 Gene:Shawn / 3772641 FlyBaseID:FBgn0031039 Length:387 Species:Drosophila melanogaster


Alignment Length:354 Identity:82/354 - (23%)
Similarity:142/354 - (40%) Gaps:77/354 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VNMTAGAIAG-VLEHVVMYPLDSVKTRMQS-----------------------LSPPTKN----- 51
            :...|.|..| ::....|.|||.:|||:|:                       ..|.|.|     
  Fly    40 LQQVASACTGAMVTACFMTPLDVIKTRLQAQQQALLSNKCFLYCNGLMDHICPCGPDTPNPAAAK 104

  Fly    52 -----MNIVSTLRTMITREGLLRPIRGASAVVLGAGPAHSLYFAAYEMTKELTAKFTSVRNLNYV 111
                 ...:.....:...||:.....|.|..::.|.|:..:||.|||..|   |:||   :::|.
  Fly   105 PAPRFSGTIDAFIKISRTEGIGSLWSGLSPTLISALPSTIIYFVAYEQFK---ARFT---DIHYK 163

  Fly   112 ISGAVATLIHD--------------------AIS--SPTDVIKQRMQMYNSPYTSVVSCVRDIYK 154
            .:....|:.||                    |::  ||.::|:.:||.....:..:...:|.:.:
  Fly   164 YTRRPDTIAHDIPHPIPFLVPLLAGVSGRILAVTCVSPVELIRTKMQSQRMTHAEMFGTIRQVVQ 228

  Fly   155 REGFKAFYRAYGTQLVMNLPYQTIHFTTYEFFQNKMN-LERKYNPPVHMAAGAAAGACAAAVTTP 218
            .:|....:|.....::.::|:..|::|.||:.::... :|..::  ...||||.:|:.||.:|||
  Fly   229 SQGVLGLWRGLPPTILRDVPFSGIYWTCYEYLKSSFGVVEPTFS--FSFAAGAISGSVAATITTP 291

  Fly   219 LDVIKT------------LLNTQETGLTRGMIEASRKIYHMAGPLGFFRGTTARVLYSMPATAIC 271
            .||:||            ..|..:...|:.:......||.|.|....|.|...|:....||.||.
  Fly   292 FDVVKTHEQIEFGEKFIFSDNPPKQVATKSVAMRLASIYRMGGVPAIFSGLGPRLFKVAPACAIM 356

  Fly   272 WSTYEFFKFYLCGLDADQYKSSITGSSEP 300
            .|::|:.|.:....:.||:..|...:..|
  Fly   357 ISSFEYGKSFFYHYNIDQHNRSNQATKGP 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578 26/115 (23%)
PTZ00168 17..280 CDD:185494 77/331 (23%)
Mito_carr 107..190 CDD:278578 18/104 (17%)
Mito_carr <215..282 CDD:278578 23/78 (29%)
ShawnNP_001027071.1 Mito_carr 39..159 CDD:278578 29/124 (23%)
Mito_carr 178..265 CDD:278578 14/86 (16%)
Mito_carr 268..371 CDD:278578 31/104 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441215
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.