DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mfrn and Tyler

DIOPT Version :9

Sequence 1:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_608327.2 Gene:Tyler / 3772349 FlyBaseID:FBgn0031038 Length:441 Species:Drosophila melanogaster


Alignment Length:399 Identity:86/399 - (21%)
Similarity:148/399 - (37%) Gaps:130/399 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 MTAGAIAGVLEHVVMYPLDSVKTRMQS-----LSPPTKNMNIV--STLRTMITREG--------- 66
            :.:..:.|::...|:.||:.||||:|:     ..|....:..|  :.|.|.:.|..         
  Fly    49 VVSALVGGLITTFVVTPLEVVKTRVQTQHAIRQRPTVSKLCYVYHNGLMTHVCRSSDICVPKPGR 113

  Fly    67 ---LLRPIRGA--------------------SAVVLGAGPAHSLYFAAYEMTKE-------LTAK 101
               .|||:|||                    |..::.|.|:..:||..||..|.       ::.|
  Fly   114 DPQNLRPLRGAMDAFVKIVCTSGFSGLWAGLSPTLVSALPSTIIYFLTYEYIKNSLSHIYLVSQK 178

  Fly   102 F--------------------------------TSVRNLNYVI---SGAVA-TLIHDAISSPTDV 130
            |                                .|..:|.|.:   ||..: |::..|| :|.::
  Fly   179 FEESGMKDQVPGADGGDPLDQATRGINVSATAPVSTASLPYYVPMASGICSRTIVVTAI-TPIEM 242

  Fly   131 IKQRMQMYNSPYTSVVSCVRDIYKREGFKAFYRAYGTQLVMNLPYQTIHFTTYEFFQNKMNLERK 195
            ::.:||.....|..:...:|.:.::.|....:|.:...::.:.|:...::..||..:...::   
  Fly   243 VRIKMQSEYMTYAELWRVLRSLIRQHGILGLWRGWPPTVMRDAPFSGTYWAVYEAIKRAFSV--- 304

  Fly   196 YNPPVHM---AAGAAAGACAAAVTTPLDVIKTLLNTQ----------ETGLTRG----------- 236
             ..|..:   ..||.:||.|..||.|.|:|.|  :||          |.|...|           
  Fly   305 -TEPTFLFSFLTGAISGAVATFVTMPFDLITT--HTQIELGQDVLYEEIGAGTGAGTGTGAGARP 366

  Fly   237 -------------MIEASRKIYHMAGPLGFFRGTTARVLYSMPATAICWSTYEFFK--FYLCGLD 286
                         ::...|:||.:.|..|.:.|...|:|..:||.||..||:|:.|  |:...||
  Fly   367 KTPQSAVANSRPSVLSRMRQIYRLQGVRGLYVGVMPRMLRVVPACAIMISTFEYSKSFFFHYNLD 431

  Fly   287 ADQ--YKSS 293
            ..:  |:.|
  Fly   432 LQEAAYRRS 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578 28/125 (22%)
PTZ00168 17..280 CDD:185494 81/382 (21%)
Mito_carr 107..190 CDD:278578 17/86 (20%)
Mito_carr <215..282 CDD:278578 28/102 (27%)
TylerNP_608327.2 Mito_carr 41..171 CDD:278578 28/121 (23%)
Mito_carr 216..302 CDD:278578 17/86 (20%)
Mito_carr 306..429 CDD:278578 34/124 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441217
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.