DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mfrn and sea

DIOPT Version :9

Sequence 1:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster


Alignment Length:277 Identity:69/277 - (24%)
Similarity:112/277 - (40%) Gaps:12/277 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VGV-NMTAGAIAGVLEHVVMYPLDSVKTRMQ--SLSPPTKNMNIVSTLRTMITREGLLRPIRGAS 75
            ||: .:.||.|.|.:|..:.||.:.|||::|  ......|...|...::..:...|.|...||.|
  Fly    32 VGLKGIVAGGITGGIEICITYPTEYVKTQLQLDEKGAAKKYNGIFDCVKKTVGERGFLGLYRGLS 96

  Fly    76 AVVLGAGPAHSLYFAAYEMTKELTAKFT-SVRNLNYVISGAVATLIHDAIS-SPTDVIKQR---- 134
            .:|.|:.|..:..|.|:|..|....... .:.|...::.|..|.:....:: :|.:.||.:    
  Fly    97 VLVYGSIPKSAARFGAFEFLKSNAVDSRGQLSNSGKLLCGLGAGVCEAIVAVTPMETIKVKFIND 161

  Fly   135 MQMYNSPYTSVVSCVRDIYKREGFKAFYRAYGTQLVMNLPYQTIHFTTYEFFQNKMNLERKYNPP 199
            .:..|..:......|..|.|.||....|:.....::.....|.|.|...|..::....:....|.
  Fly   162 QRSGNPKFRGFAHGVGQIIKSEGISGIYKGLTPTILKQGSNQAIRFFVLESLKDLYKGDDHTKPV 226

  Fly   200 VHMAA---GAAAGACAAAVTTPLDVIKTLLNTQETGLTRGMIEASRKIYHMAGPLGFFRGTTARV 261
            ..:..   ||.|||.:....|||||:||.:...|....:.....:.:|....||..|::||..|:
  Fly   227 PKLVVGVFGAIAGAASVFGNTPLDVVKTRMQGLEASKYKNTAHCAVEILKNEGPAAFYKGTVPRL 291

  Fly   262 LYSMPATAICWSTYEFF 278
            .......||.:..|:.|
  Fly   292 GRVCLDVAITFMIYDSF 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578 27/86 (31%)
PTZ00168 17..280 CDD:185494 67/273 (25%)
Mito_carr 107..190 CDD:278578 17/87 (20%)
Mito_carr <215..282 CDD:278578 19/64 (30%)
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 65/267 (24%)
Mito_carr 34..117 CDD:278578 24/82 (29%)
Mito_carr 125..220 CDD:278578 17/94 (18%)
Mito_carr 235..314 CDD:278578 24/74 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441243
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.