DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mfrn and Mpcp1

DIOPT Version :9

Sequence 1:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster


Alignment Length:333 Identity:73/333 - (21%)
Similarity:125/333 - (37%) Gaps:70/333 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SLPTTSVGV----------------NMTAGAIA-------------------GVLE----HVVMY 33
            |.||::..|                |:.|.|:|                   |::.    |.::.
  Fly    30 SAPTSTAVVTPTLKDVAPRQLTRNHNIAAAAVAEGDSCEFGSNHYFLLCGLGGIISCGSTHTMVV 94

  Fly    34 PLDSVKTRMQSLSPPTKNMNIVSTLRTMITREGLLRPIRGASAVVLGAGPAHSLYFAAYEMTKEL 98
            |||.||.|:|  ..|.|..::.:..|..:..||:....:|.:...:|........|..||:.|::
  Fly    95 PLDLVKCRLQ--VDPAKYKSVFTGFRISLAEEGVRGLAKGWAPTFIGYSMQGLCKFGLYEVFKKV 157

  Fly    99 TAKFTSVRNL------NYVISGAVATLIHDAISSPTDVIKQRMQMYNSPYTSVVSCVRDIYKREG 157
            ........|.      .|:.:.|.|....|...:|.:..|.::|.......::...:..:..:||
  Fly   158 YGDAIGEENAFLYRTGLYLAASASAEFFADIALAPMEAAKVKIQTTPGFAKTLREALPKMTAQEG 222

  Fly   158 FKAFYRAYGTQLVMNLPYQTIHFTTYEFFQNKMNLERKYNPP-------------VHMAAGAAAG 209
            ..|||:......:..:||..:.|..   |:..:.|..||..|             |..|||..||
  Fly   223 VTAFYKGLVPLWMRQIPYTMMKFAC---FERTLELLYKYVVPKPRADCTKGEQLVVTFAAGYIAG 284

  Fly   210 ACAAAVTTPLDVIKTLLNTQETGLTRGMIEASRKIYHMAGPLGFFRGTTARVLYSMPATAICWST 274
            ...|.|:.|.|.:.:.|| |..|.:  .::.::::    |..|.:.|...|::.....||..|..
  Fly   285 VFCAIVSHPADTVVSKLN-QAKGAS--ALDVAKQL----GWSGLWGGLVPRIVMIGTLTAAQWFI 342

  Fly   275 YEFFKFYL 282
            |:..|.:|
  Fly   343 YDAVKVFL 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578 25/123 (20%)
PTZ00168 17..280 CDD:185494 67/304 (22%)
Mito_carr 107..190 CDD:278578 17/88 (19%)
Mito_carr <215..282 CDD:278578 16/66 (24%)
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 20/90 (22%)
Mito_carr <188..258 CDD:278578 13/72 (18%)
Mito_carr 273..350 CDD:278578 23/83 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441227
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.