DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mfrn and CG4995

DIOPT Version :9

Sequence 1:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster


Alignment Length:325 Identity:76/325 - (23%)
Similarity:144/325 - (44%) Gaps:39/325 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VNMTAGAIAGVLEHVVMYPLDSVKTRMQSLSPPTKNMNIVST---LRTMITREGLLRPIRGASAV 77
            |:..||.:.|....:|.:|.|:||..:|:..|  :|.....|   .||::.|:..:...||.|:.
  Fly    42 VDFVAGLLGGAAGVLVGHPFDTVKVHLQTDDP--RNPKYKGTFHCFRTIVQRDKFIGLYRGISSP 104

  Fly    78 VLGAGPAHSLYFAAYEMTKELTAKFTSVRNLNYVISGAVATLIHDAISSPTDVIKQRMQMYNS-- 140
            :.|.|..:::.|..|...:.|:....|:  .::..:|::|.:....:.:|.::.|.|:|:...  
  Fly   105 MGGIGLVNAIVFGVYGNVQRLSNDPNSL--TSHFFAGSIAGVAQGFVCAPMELAKTRLQLSTQVD 167

  Fly   141 ---PYTSVVSCVRDIYKREGFKAFYRAYGTQLVMNLPYQTIHFTTYEFFQNKMNLERKYNPP--- 199
               .:|..:.|::.|.|.||.:..::.....::.::|....:|.::|:      |.|:...|   
  Fly   168 SGIKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSFEY------LMRQVETPGVA 226

  Fly   200 VHMAAGAAAGACAAAVTTPLDVIKTLLNTQETGLT---RGMIEASRKIYHMAGPLGFFRGTTARV 261
            ..:.||..||..:.....|:||:||.:.....|..   .|.|:.:.|.:...||..||||..:.:
  Fly   227 YTLMAGGCAGMSSWLACYPIDVVKTHMQADALGANAKYNGFIDCAMKGFRNEGPQYFFRGLNSTL 291

  Fly   262 LYSMPATAICWSTYEFFKFYLC----GLDADQYKSSITGSSEPRKADYVLPRTTDEEQIDQEREA 322
            :.:.|..|.|:....:. ..:|    |:|      |:..|.:|    ..|....::.|.|.|..|
  Fly   292 IRAFPMNAACFFVVSWV-LDICNAKGGMD------SVMHSDQP----LTLVNLDNKSQADLEATA 345

  Fly   323  322
              Fly   346  345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578 23/84 (27%)
PTZ00168 17..280 CDD:185494 64/276 (23%)
Mito_carr 107..190 CDD:278578 15/87 (17%)
Mito_carr <215..282 CDD:278578 18/69 (26%)
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 23/84 (27%)
PTZ00169 41..295 CDD:240302 62/262 (24%)
Mito_carr 128..218 CDD:278578 17/97 (18%)
Mito_carr 221..304 CDD:278578 23/82 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441214
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.