DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mfrn and Ucp4B

DIOPT Version :9

Sequence 1:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster


Alignment Length:304 Identity:75/304 - (24%)
Similarity:128/304 - (42%) Gaps:49/304 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TTSVGVNMTAGAIAGVLEHVVMYPLDSVKTRMQ-------SLSPPTKNMNIVSTLRTMITREGLL 68
            |..|.:.:||.|.|...| :|.||.|..|||||       .:....|...:::|...::..||||
  Fly    34 TPPVELYLTAFASACSAE-IVGYPFDMCKTRMQIQGEIASRVGQKAKYRGLLATAMGIVREEGLL 97

  Fly    69 RPIRGASAVVLGAGPAHSLYFAAYEMTKELTAKFTSVRN---------LNYVISGAVATLIHDAI 124
            :...|.||::.    .|||:.....:|.:...:...|.:         |...|||.:|......:
  Fly    98 KLYGGISAMLF----RHSLFSGIKMLTYDYMREKMIVPDEDGRPQLSFLGSCISGVLAGATASVL 158

  Fly   125 SSPTDVIKQRMQMYNS--------PYTSVVSCVRDIYKREGFKAFYR-----AYGTQLVMNLPYQ 176
            ::||::||.:|||...        ...:|:..:..||:..|....::     .:.:.||      
  Fly   159 TNPTELIKIQMQMEGQRRLRGEPPRIHNVLQALTSIYRTGGVVGLWKGTVPNTWRSALV------ 217

  Fly   177 TI-HFTTYEFFQNKMNLERKY--NPPVHMAAGAAAGACAAAVTTPLDVIKTLLNTQET-----GL 233
            || ..:.|:|.:..:..|...  |..|...|...||...|.::.|.||:|:.:..|.|     |:
  Fly   218 TIGDVSCYDFCKRFLIAEFDLVDNREVQFVAAMTAGVADAILSLPADVVKSRIMNQPTDEQGRGI 282

  Fly   234 -TRGMIEASRKIYHMAGPLGFFRGTTARVLYSMPATAICWSTYE 276
             .:|.::...::....|.|..::|.....:...||:.:.|.|:|
  Fly   283 HYKGSLDCLSRLVREEGFLAMYKGFIPYWMRVGPASVVFWMTFE 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578 28/91 (31%)
PTZ00168 17..280 CDD:185494 73/298 (24%)
Mito_carr 107..190 CDD:278578 22/105 (21%)
Mito_carr <215..282 CDD:278578 16/68 (24%)
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 69/282 (24%)
Mito_carr 32..129 CDD:278578 29/99 (29%)
Mito_carr 138..233 CDD:278578 22/100 (22%)
Mito_carr 246..331 CDD:278578 20/81 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441221
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.