DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mfrn and Ucp4C

DIOPT Version :9

Sequence 1:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster


Alignment Length:315 Identity:79/315 - (25%)
Similarity:130/315 - (41%) Gaps:43/315 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNIDDYESLPTTSVGVNMTAGAI----------AGVLEHVVMYPLDSVKTRMQSLSPPTKNM--- 52
            :.|::....|.|:|...:||..:          |.:.|..| :|||..|||||......|..   
  Fly    14 LEIEEEPRFPPTNVADPLTARNLFQLYVNTFIGANLAESCV-FPLDVAKTRMQVDGEQAKKTGKA 77

  Fly    53 --NIVSTLRTMITREGLLRPIRGASAVVLGAGPAHSLYFAAYEMTKELTAKFTSVRNLN----YV 111
              ...:||..||..||......|.||:|......:||....|::.:. ...:.:.||..    |:
  Fly    78 MPTFRATLTNMIRVEGFKSLYAGFSAMVTRNFIFNSLRVVLYDVFRR-PFLYQNERNEEVLKIYM 141

  Fly   112 ISGA--VATLIHDAISSPTDVIKQRMQM--------YNSPYTSVVSCVRDIYKREGFKAFYRAYG 166
            ..|.  .|..|..|:::|.|::|.|||.        |:....|:|....|||:|.|..:.::..|
  Fly   142 ALGCSFTAGCIAQALANPFDIVKVRMQTEGRRRQLGYDVRVNSMVQAFVDIYRRGGLPSMWKGVG 206

  Fly   167 TQLVMNLPYQTIHFTTYEF----FQNKMNLERKYNPPVHMAAGAAAGACAAAVTTPLDVIKTLLN 227
            ...:......|....:|:.    |:..::||.  ..|:...:...||..|:.::||.||||:.:.
  Fly   207 PSCMRACLMTTGDVGSYDISKRTFKRLLDLEE--GLPLRFVSSMCAGLTASVLSTPADVIKSRMM 269

  Fly   228 TQ---ETGLT---RGMIEASRKIYHMAGPLGFFRGTTARVLYSMPATAICWSTYE 276
            .|   |:|..   :..::..||:....|.|..::|.........|.:.:.|.:.|
  Fly   270 NQPVDESGKNLYYKNSLDCVRKLVREEGVLTLYKGLMPTWFRLGPFSVLFWLSVE 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578 28/99 (28%)
PTZ00168 17..280 CDD:185494 75/299 (25%)
Mito_carr 107..190 CDD:278578 24/100 (24%)
Mito_carr <215..282 CDD:278578 17/68 (25%)
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 24/75 (32%)
Mito_carr 137..232 CDD:278578 23/94 (24%)
Mito_carr 237..329 CDD:278578 22/90 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441222
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.