DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mfrn and colt

DIOPT Version :9

Sequence 1:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster


Alignment Length:279 Identity:70/279 - (25%)
Similarity:122/279 - (43%) Gaps:19/279 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GAIAGVLEHVVMYPLDSVKTRMQSLSPPTKN-----MNIVSTLRTMITREGLLRPIRGASAVVLG 80
            |...|:...:..:|||::|.|:|::..|...     ..........|..||:....:|.||.:.|
  Fly    22 GGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYKGMSAPLTG 86

  Fly    81 AGPAHSLYFAAYEMTKELTAKFTSVRNLNY---VISGAVATLIHDAISSPTDVIK-----QRMQM 137
            ..|..::.||.|.:.|.|..:....: |.|   .::|:.:.|....|.:|.:.||     |:.|.
  Fly    87 VAPIFAMCFAGYALGKRLQQRGEDAK-LTYPQIFVAGSFSGLFSTLIMAPGERIKVLLQTQQGQG 150

  Fly   138 YNSPYTSVVSCVRDIYKREGFKAFYRAYGTQLVMNLPYQTIHFTTYEFFQN--KMNLER-KYNPP 199
            ....|..::.|...:||..|.::.::.....::.:||...::|..||..|:  |...|. :.:..
  Fly   151 GERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVYEALQDVAKSKSETGQISTA 215

  Fly   200 VHMAAGAAAGACAAAVTTPLDVIKTLLNTQETGLTR-GMIEASRKIYHMAGPLGFFRGTTARVLY 263
            ..:.||..||.....:..|.||:|:.|.:...|..: |:....:.:....|||..:||.|..:|.
  Fly   216 STIFAGGVAGMAYWILGMPADVLKSRLQSAPEGTYKHGIRSVFKDLIVKDGPLALYRGVTPIMLR 280

  Fly   264 SMPATAICWSTYEFF-KFY 281
            :.||.|.|:...|.. ||:
  Fly   281 AFPANAACFFGIELANKFF 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578 21/81 (26%)
PTZ00168 17..280 CDD:185494 68/276 (25%)
Mito_carr 107..190 CDD:278578 21/92 (23%)
Mito_carr <215..282 CDD:278578 21/69 (30%)
coltNP_477221.1 Mito_carr 12..107 CDD:395101 22/84 (26%)
Mito_carr 112..202 CDD:395101 21/90 (23%)
Mito_carr 210..299 CDD:395101 24/88 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441224
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.