DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mfrn and sesB

DIOPT Version :9

Sequence 1:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster


Alignment Length:290 Identity:59/290 - (20%)
Similarity:105/290 - (36%) Gaps:56/290 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 NMTAGAIAGVLEHVVMYPLDSVKTRMQ------SLSPPTKNMNIVSTLRTMITREGLLRPIRGAS 75
            :..||.|:..:....:.|::.||..:|      .:||..:...:|.....:...:|.....||..
  Fly    26 DFAAGGISAAVSKTAVAPIERVKLLLQVQHISKQISPDKQYKGMVDCFIRIPKEQGFSSFWRGNL 90

  Fly    76 AVVLGAGPAHSLYFAAYEMTKELTAKFTSVRNLNY-------VISGAVATLIHDAISSPTDVIKQ 133
            |.|:...|..:|.||..:..|::...... :|..:       :.||..|.........|.|..:.
  Fly    91 ANVIRYFPTQALNFAFKDKYKQVFLGGVD-KNTQFWRYFAGNLASGGAAGATSLCFVYPLDFART 154

  Fly   134 RMQMYNS-----PYTSVVSCVRDIYKREGFKAFYRAYGTQLVMNLPYQTIHFTTYEFFQNKMNLE 193
            |:.....     .:|.:.:|:..|:|.:|....||.:|..:...:.|:..:|..|:..:..  |.
  Fly   155 RLAADTGKGGQREFTGLGNCLTKIFKSDGIVGLYRGFGVSVQGIIIYRAAYFGFYDTARGM--LP 217

  Fly   194 RKYNPPVHM--AAGAAAGACAAAVTTPLDVIKTLLNTQETGLTRGMIEASRKIYHMAGPLGFFRG 256
            ...|.|:::  |........|..|:.|.|.::          .|.|:::.||             
  Fly   218 DPKNTPIYISWAIAQVVTTVAGIVSYPFDTVR----------RRMMMQSGRK------------- 259

  Fly   257 TTARVLYSMPATAICWSTY-------EFFK 279
             ...|:|.  .|..||:|.       .|||
  Fly   260 -ATEVIYK--NTLHCWATIAKQEGTGAFFK 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578 20/86 (23%)
PTZ00168 17..280 CDD:185494 59/290 (20%)
Mito_carr 107..190 CDD:278578 18/94 (19%)
Mito_carr <215..282 CDD:278578 16/72 (22%)
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 20/89 (22%)
PTZ00169 23..312 CDD:240302 59/290 (20%)
Mito_carr 124..220 CDD:278578 18/97 (19%)
Mito_carr 223..312 CDD:278578 19/90 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441247
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.