DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mfrn and CG1628

DIOPT Version :9

Sequence 1:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster


Alignment Length:309 Identity:86/309 - (27%)
Similarity:135/309 - (43%) Gaps:50/309 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NIDDYESLPTTSVGVNMTAGAIAGVLEHVVMYPLDSVKTRMQSLSPPTKNM--NIVSTLRTMITR 64
            ||:..|.|      ::..||::.|..:..|..|||:||.::|:.....:.|  ..:||.|    :
  Fly   163 NINFVEGL------IDFLAGSLGGAAQVYVSQPLDTVKVKLQTFPEAYRGMLDCFLSTYR----K 217

  Fly    65 EGLLRPIRGASAVVLGAGPA-HSLYFAAYE---------MTKELTAKFTSVRNLNYVISGAVATL 119
            :|:||.:...|...:.|..| :|:.||||.         :.||.....|:|:|   ..:|::|..
  Fly   218 DGVLRGLYAGSVPAVFANVAENSVLFAAYGGCQKFVAFCVGKETAGDLTTVQN---ACAGSLAAC 279

  Fly   120 IHDAISSPTDVIKQRMQ----MYN-----------SPYTSVVSCVRDIYKREGFKAFYRAYGTQL 169
            .......||::||.::|    |.|           :|:|    ..|.|::.||.:.|||...:..
  Fly   280 FSTLTLCPTELIKCKLQALREMKNFVEPAHPQDIRTPWT----LTRYIWRTEGIRGFYRGLSSTF 340

  Fly   170 VMNLPYQTIHFTTYEFFQNKMNLERK----YNPPVHMAAGAAAGACAAAVTTPLDVIKTLLNTQE 230
            :..:|.....|.:||..:..:..:.:    ..|...|.|||..|.|....|.|.||||:.:  |.
  Fly   341 LREMPGYFFFFGSYEGTRELLRRDDQSKDDIGPLRTMIAGAIGGVCLWTSTFPADVIKSRI--QV 403

  Fly   231 TGLTRGMIEASRKIYHMAGPLGFFRGTTARVLYSMPATAICWSTYEFFK 279
            ..|...|......|....|.|..:||....||.::||||..:..||:.|
  Fly   404 KNLNESMFAVGADIVRREGVLALYRGLLPSVLRTIPATATLFVVYEYTK 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578 26/96 (27%)
PTZ00168 17..280 CDD:185494 82/294 (28%)
Mito_carr 107..190 CDD:278578 23/97 (24%)
Mito_carr <215..282 CDD:278578 23/65 (35%)
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 86/309 (28%)
Mito_carr 170..252 CDD:278578 26/91 (29%)
Mito_carr 263..364 CDD:278578 25/107 (23%)
Mito_carr 369..455 CDD:278578 30/86 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441229
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.