powered by:
Protein Alignment mfrn and nars-1
DIOPT Version :9
Sequence 1: | NP_651600.1 |
Gene: | mfrn / 43353 |
FlyBaseID: | FBgn0039561 |
Length: | 379 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001021405.1 |
Gene: | nars-1 / 172442 |
WormBaseID: | WBGene00003815 |
Length: | 545 |
Species: | Caenorhabditis elegans |
Alignment Length: | 39 |
Identity: | 11/39 - (28%) |
Similarity: | 17/39 - (43%) |
Gaps: | 0/39 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 334 SAPTSVNASGAIKTVCELSTRPAGPTINLHTRHTDVKSP 372
|..|||...|.||.:.:..:.|.|..:.:.......|:|
Worm 170 STETSVQVYGIIKALPDGKSAPDGHELTVDYWEVIGKAP 208
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1056670at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.