DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mfrn and nars-1

DIOPT Version :9

Sequence 1:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001021405.1 Gene:nars-1 / 172442 WormBaseID:WBGene00003815 Length:545 Species:Caenorhabditis elegans


Alignment Length:39 Identity:11/39 - (28%)
Similarity:17/39 - (43%) Gaps:0/39 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 SAPTSVNASGAIKTVCELSTRPAGPTINLHTRHTDVKSP 372
            |..|||...|.||.:.:..:.|.|..:.:.......|:|
 Worm   170 STETSVQVYGIIKALPDGKSAPDGHELTVDYWEVIGKAP 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578
PTZ00168 17..280 CDD:185494
Mito_carr 107..190 CDD:278578
Mito_carr <215..282 CDD:278578
nars-1NP_001021405.1 AsnS 108..545 CDD:223096 11/39 (28%)
AsnRS_cyto_like_N 123..206 CDD:239818 9/35 (26%)
AsxRS_core 220..541 CDD:238399
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1056670at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.