DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NSD and SET4

DIOPT Version :9

Sequence 1:NP_733239.1 Gene:NSD / 43351 FlyBaseID:FBgn0039559 Length:1427 Species:Drosophila melanogaster
Sequence 2:NP_012430.1 Gene:SET4 / 853339 SGDID:S000003641 Length:560 Species:Saccharomyces cerevisiae


Alignment Length:410 Identity:84/410 - (20%)
Similarity:136/410 - (33%) Gaps:136/410 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly  1005 CVKGGE------LVCCETCPIAVHAHC----RNIPIKTNESYICEECESGRLPLYGEIVWAKFNN 1059
            |:.|..      .:.|..|....|..|    ::.|||  ..::|:.|:|                
Yeast   163 CICGSSDSKDELFIQCNKCKTWQHKLCYAFKKSDPIK--RDFVCKRCDS---------------- 209

  Fly  1060 FRWWPAIILPPTEVPSNILKKAHGENDFVVRFFGTHDHGWISRRRVYLYIEGDTGDGHKTKSQLF 1124
                      .|:|..|                                         :.|..:|
Yeast   210 ----------DTKVQVN-----------------------------------------QVKPMIF 223

  Fly  1125 RNYTTGVEEASRFLPIIKARRQEQDMERQSGNKLHPPPYVKIKTNKAVPPLRFSQNLEDLSTCNC 1189
            .. ..|.|...:|..|:.......:..:||.|.:...| .|.:.:...|....|.::........
Yeast   224 PR-KMGDERLFQFSSIVTTSASNTNQHQQSVNNIEEQP-KKRQLHYTAPTTENSNSIRKKLRQEK 286

  Fly  1190 LPVDEH---PCGPEAGCLNRMLF-----NECNPEYCKA---------GSLCENRMFEQRKSPRLE 1237
            |.|..|   |...|....|...|     :|...:|.|.         ..:|.|  :|..:|..:|
Yeast   287 LVVSSHFLKPLLNEVSSSNDTEFKAITISEYKDKYVKMFIDNHYDDDWVVCSN--WESSRSADIE 349

  Fly  1238 V-VYMNERGFGLVNREPIAVGDFVIEYVGEVINHAEFQRRMEQKQRDRDENYYFLGVEKDFI--- 1298
            | ...|||.||:...:....|:.:.||:|::    :||:..   |.|.:.:|..:|..|..:   
Yeast   350 VRKSSNERDFGVFAADSCVKGELIQEYLGKI----DFQKNY---QTDPNNDYRLMGTTKPKVLFH 407

  Fly  1299 ------IDAGPKGNLARFMNHSCEPNCETQKWTV-----------NCIHRVGIFAIKDIPVNSEL 1346
                  ||:...|.|.|::..|||||.|..  ||           :|..:..:.||:||....|:
Yeast   408 PHWPLYIDSRETGGLTRYIRRSCEPNVELV--TVRPLDEKPRGDNDCRVKFVLRAIRDIRKGEEI 470

  Fly  1347 TFNYLWD------DLMNNSK 1360
            :..:.||      :::|.||
Yeast   471 SVEWQWDLRNPIWEIINASK 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NSDNP_733239.1 MSH6_like 391..508 CDD:99898
PHD2_NSD 867..932 CDD:277040
PHD3_NSD 933..988 CDD:277041
PHD4_NSD 1001..1041 CDD:277042 10/45 (22%)
WHSC1_related 1047..1141 CDD:99899 8/93 (9%)
AWS 1183..1233 CDD:197795 13/66 (20%)
SET 1234..1354 CDD:214614 39/146 (27%)
SET4NP_012430.1 SET 16..526 CDD:225491 84/410 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4489
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.