DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NSD and SET2

DIOPT Version :9

Sequence 1:NP_733239.1 Gene:NSD / 43351 FlyBaseID:FBgn0039559 Length:1427 Species:Drosophila melanogaster
Sequence 2:NP_012367.2 Gene:SET2 / 853271 SGDID:S000003704 Length:733 Species:Saccharomyces cerevisiae


Alignment Length:321 Identity:97/321 - (30%)
Similarity:152/321 - (47%) Gaps:43/321 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1109 IEGDTGDGHKTKSQLFRNYTTGVEEASRFLPIIKARRQEQDMERQSGNKLHPPPYVKIKTNKAVP 1173
            |..:..:|||.: :||                    .||.|:..::..|....... |..||.:.
Yeast    16 ILNNNAEGHKPQ-RLF--------------------DQEPDLTEEALTKFENLDDC-IYANKRIG 58

  Fly  1174 PLRFSQNLEDLSTCNCLPVDE------HPCGPEAGCLNRMLFNECNPEYCKA-GSLCENRMFEQR 1231
              .|..|  |...|:|  .:|      |.|..::.|:||:...||..:.|.: |:.|:|:.|:::
Yeast    59 --TFKNN--DFMECDC--YEEFSDGVNHACDEDSDCINRLTLIECVNDLCSSCGNDCQNQRFQKK 117

  Fly  1232 KSPRLEVVYMNERGFGLVNREPIAVGDFVIEYVGEVINHAEFQRRMEQKQRDRDENYYFLGVEKD 1296
            :...:.:.....:|:|:...:.|....|:.||.||||...||:.|:....:...:::||:.::..
Yeast   118 QYAPIAIFKTKHKGYGVRAEQDIEANQFIYEYKGEVIEEMEFRDRLIDYDQRHFKHFYFMMLQNG 182

  Fly  1297 FIIDAGPKGNLARFMNHSCEPNCETQKWTVNCIHRVGIFAIKDIPVNSELTFNYLWDDLMNNSKK 1361
            ..|||..||:||||.||||.||....||.|....|:||||.:.|....|:||:|..|.....::|
Yeast   183 EFIDATIKGSLARFCNHSCSPNAYVNKWVVKDKLRMGIFAQRKILKGEEITFDYNVDRYGAQAQK 247

  Fly  1362 ACFCGAKRCSGEIGGKLKDDAVKAHAKLKQMRRAKASAVRIHVKPKKTPKVKHISADDEPM 1422
             |:|....|.|.:|||.:.||    |.|.....|.|..|.:.:: ||..|:|.:|.  ||:
Yeast   248 -CYCEEPNCIGFLGGKTQTDA----ASLLPQNIADALGVTVSME-KKWLKLKKLSG--EPI 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NSDNP_733239.1 MSH6_like 391..508 CDD:99898
PHD2_NSD 867..932 CDD:277040
PHD3_NSD 933..988 CDD:277041
PHD4_NSD 1001..1041 CDD:277042
WHSC1_related 1047..1141 CDD:99899 6/31 (19%)
AWS 1183..1233 CDD:197795 16/56 (29%)
SET 1234..1354 CDD:214614 43/119 (36%)
SET2NP_012367.2 AWS 64..119 CDD:197795 16/56 (29%)
SET_SETD2 119..260 CDD:380949 49/141 (35%)
SET 215..695 CDD:225491 33/94 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 106 1.000 Domainoid score I1445
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22884
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4489
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.