DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NSD and ASHH3

DIOPT Version :9

Sequence 1:NP_733239.1 Gene:NSD / 43351 FlyBaseID:FBgn0039559 Length:1427 Species:Drosophila melanogaster
Sequence 2:NP_566010.1 Gene:ASHH3 / 819021 AraportID:AT2G44150 Length:363 Species:Arabidopsis thaliana


Alignment Length:272 Identity:87/272 - (31%)
Similarity:134/272 - (49%) Gaps:48/272 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1156 NKLHPPPYVKIKTNKAVPPLRFSQNLEDLST-CNCLPVDEHP------CGPEAGCLNRMLFNECN 1213
            ||..|.||:.|:.|..:.. :..:.:||... |:|  ....|      ||....|  .|||:.|:
plant    37 NKGKPTPYIFIRRNIYLTK-KVKRRVEDDGIFCSC--SSSSPGSSSTVCGSNCHC--GMLFSSCS 96

  Fly  1214 PEYCKAGSLCENRMFEQRKSPRLEVVYMNERGFGLVNREPIAVGDFVIEYVGEVINHAEFQRRME 1278
            .. ||.||.|.|:.|:||...:::::...:.|.|:|..|.|..|:|:||||||||:....:.|:.
plant    97 SS-CKCGSECNNKPFQQRHVKKMKLIQTEKCGSGIVAEEEIEAGEFIIEYVGEVIDDKTCEERLW 160

  Fly  1279 QKQRDRDENYYFLGVEKDFIIDAGPKGNLARFMNHSCEPNCETQKWTVNCIHRVGIFAIKDIPVN 1343
            :.:...:.|:|...:.:|.:|||..|||.:|::||||.||.:.|||.::...|:||||.:.|...
plant   161 KMKHRGETNFYLCEITRDMVIDATHKGNKSRYINHSCNPNTQMQKWIIDGETRIGIFATRGIKKG 225

  Fly  1344 SELTFNYLWDDLMNNSKKACFCGAKRCSGEIGGKLKDDAVKAHAKLKQMRRAKASAVRIHVKPKK 1408
            ..||::|.:  :...:.:.|.|||..|..::|                            |||.|
plant   226 EHLTYDYQF--VQFGADQDCHCGAVGCRRKLG----------------------------VKPSK 260

  Fly  1409 TPKVKHISADDE 1420
             ||:    |.||
plant   261 -PKI----ASDE 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NSDNP_733239.1 MSH6_like 391..508 CDD:99898
PHD2_NSD 867..932 CDD:277040
PHD3_NSD 933..988 CDD:277041
PHD4_NSD 1001..1041 CDD:277042
WHSC1_related 1047..1141 CDD:99899
AWS 1183..1233 CDD:197795 20/56 (36%)
SET 1234..1354 CDD:214614 44/119 (37%)
ASHH3NP_566010.1 SET_ASHR3-like 117..255 CDD:380952 49/139 (35%)
Tudor_Agenet_AtEML-like 313..362 CDD:410475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1081
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22884
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.