DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL4 and YML6

DIOPT Version :9

Sequence 1:NP_524538.2 Gene:RpL4 / 43349 FlyBaseID:FBgn0003279 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_013687.1 Gene:YML6 / 854983 SGDID:S000004487 Length:286 Species:Saccharomyces cerevisiae


Alignment Length:200 Identity:38/200 - (19%)
Similarity:72/200 - (36%) Gaps:43/200 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LGNAR--PLVSVYTEKNEPAKDKNICLP---AVFKAPIRPDVVNEVHQLLRRNNRQAYAVSELAG 62
            |.||.  |..::.|.::.|:.:....:|   :...||:|.|::  ...::..|:.:....|...|
Yeast    32 LPNAAIPPKYALVTVRSFPSLEPLTFVPVPTSTVAAPLRRDIL--WRAVVYENDNRRVGASNPPG 94

  Fly    63 HQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFA-----------PTKTFRRWHR 116
            ...:      |.:..::...:|.|..|.|.........|||..|           |:|.:.....
Yeast    95 RSEN------GFSRRKLMPQKGSGRARVGDANSPTRHNGGRALARTAPNDYTTELPSKVYSMAFN 153

  Fly   117 KVNVNQRRYALVSAIAASGVPALVQSKGHVIDGVSEFP--------LVVSDEVQKVQKTKQAVIF 173
            ....:|.:...:..|.           |..:|.:|..|        ||.::.|:..:..:..|||
Yeast   154 NALSHQYKSGKLFVIG-----------GEKVDLISPTPELDLNRLDLVNTNTVEGKEIFEGEVIF 207

  Fly   174 LRRLK 178
            .:.|:
Yeast   208 RKFLE 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL4NP_524538.2 PTZ00428 6..383 CDD:185611 36/196 (18%)
Ribosomal_L4 10..268 CDD:294231 34/190 (18%)
Ribos_L4_asso_C 278..350 CDD:291072
YML6NP_013687.1 Ribosomal_L4 58..272 CDD:395455 32/173 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0088
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.