DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL4 and AT3G04230

DIOPT Version :10

Sequence 1:NP_524538.2 Gene:RpL4 / 43349 FlyBaseID:FBgn0003279 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_187073.1 Gene:AT3G04230 / 819578 AraportID:AT3G04230 Length:146 Species:Arabidopsis thaliana


Alignment Length:75 Identity:21/75 - (28%)
Similarity:30/75 - (40%) Gaps:19/75 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 RMFAPTKTFRRWHRKVNVNQRRYAL-------VSAIAASGVPALV---------QSKGHVIDGVS 151
            ::|.|.....: ||...|:.|..|.       |.||..|...|||         |||..:.|.:.
plant    50 KIFEPVLLLGK-HRFAGVDMRIRATGGGNTSRVYAIRQSIAKALVAYYQKYVDEQSKKEIKDILM 113

  Fly   152 EF--PLVVSD 159
            .:  .|:|:|
plant   114 RYDRTLLVAD 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL4NP_524538.2 PTZ00428 6..383 CDD:185611 21/75 (28%)
AT3G04230NP_187073.1 PLN00210 6..146 CDD:177799 21/75 (28%)

Return to query results.
Submit another query.