DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL4 and Rpl4

DIOPT Version :9

Sequence 1:NP_524538.2 Gene:RpL4 / 43349 FlyBaseID:FBgn0003279 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_077174.1 Gene:Rpl4 / 67891 MGIID:1915141 Length:419 Species:Mus musculus


Alignment Length:413 Identity:254/413 - (61%)
Similarity:311/413 - (75%) Gaps:24/413 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ARPLVSVYTEKNEPAKDKNICLPAVFKAPIRPDVVNEVHQLLRRNNRQAYAVSELAGHQTSAESW 70
            ||||:|||:||.| :..||:.||||||||||||:||.||..||:||||.||||||||||||||||
Mouse     4 ARPLISVYSEKGE-SSGKNVTLPAVFKAPIRPDIVNFVHTNLRKNNRQPYAVSELAGHQTSAESW 67

  Fly    71 GTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTFRRWHRKVNVNQRRYALVSAIAASG 135
            ||||||||||||||||||||||||||||||||||||||||:|||||:||..|:|||:.||:|||.
Mouse    68 GTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTWRRWHRRVNTTQKRYAICSALAASA 132

  Fly   136 VPALVQSKGHVIDGVSEFPLVVSDEVQKVQKTKQAVIFLRRLKIWADIQKVYKSQRFRAGRGTMR 200
            :||||.||||.|:.|.|.||||.|:|:..:|||:||..|::||.|.||:|||.|||.|||:|.||
Mouse   133 LPALVMSKGHRIEEVPELPLVVEDKVEGYKKTKEAVQLLKKLKAWNDIKKVYASQRMRAGKGKMR 197

  Fly   201 DRRRIARRGPLVVYDKDEGLRKAFRNIPGIETINVDKLNLLKLAPGGHVGRFVIWTESAFARLND 265
            :||||.||||.::|::|.|:.|||||||||..:||.|||:||||||||||||.|||||||.:|::
Mouse   198 NRRRIQRRGPCIIYNEDNGIIKAFRNIPGITLLNVSKLNILKLAPGGHVGRFCIWTESAFRKLDE 262

  Fly   266 LFGTWKKPSTLKKGYNLPQPKMANTDLSRLLKSEEIRKVLRDPRKRVFRSVRRLNPLTNVRQLIK 330
            |:|||:|.::||..||||..||.||||||:|||.||::.||.|||::.|.|.:.|||.|:|.::|
Mouse   263 LYGTWRKAASLKSNYNLPMHKMMNTDLSRILKSPEIQRALRAPRKKIHRRVLKKNPLKNLRIMLK 327

  Fly   331 LNPYAEVLKRRAALAAEKRTVAKVLAKAKKQNVELAKSHFANVATK------------AAANRAK 383
            |||||:.::|...|...:.      .|.:.:.:|.|.:..|..:.|            |...:.|
Mouse   328 LNPYAKTMRRNTILRQARN------HKLRVKKLEAAATALATKSEKVVPEKGTADKKPAVGKKGK 386

  Fly   384 LLAARK-----KKVAAKKPAAKK 401
            .:.|:|     |||.|||||.||
Mouse   387 KVDAKKQKPAGKKVVAKKPAEKK 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL4NP_524538.2 PTZ00428 6..383 CDD:185611 241/388 (62%)
Ribosomal_L4 10..268 CDD:294231 188/257 (73%)
Ribos_L4_asso_C 278..350 CDD:291072 37/71 (52%)
Rpl4NP_077174.1 PTZ00428 2..352 CDD:185611 236/354 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..419 15/46 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838115
Domainoid 1 1.000 374 1.000 Domainoid score I877
eggNOG 1 0.900 - - E1_COG0088
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H748
Inparanoid 1 1.050 500 1.000 Inparanoid score I1353
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53550
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003183
OrthoInspector 1 1.000 - - oto93042
orthoMCL 1 0.900 - - OOG6_100849
Panther 1 1.100 - - LDO PTHR19431
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1140
SonicParanoid 1 1.000 - - X2143
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.