DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL4 and Mrpl4

DIOPT Version :9

Sequence 1:NP_524538.2 Gene:RpL4 / 43349 FlyBaseID:FBgn0003279 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001344828.1 Gene:Mrpl4 / 66163 MGIID:2137210 Length:300 Species:Mus musculus


Alignment Length:177 Identity:41/177 - (23%)
Similarity:59/177 - (33%) Gaps:63/177 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RPLVSVYTEKNEPAKDKNICL----PAVFKAPIRPDVVNEVHQLLRRNNRQAYA----------- 56
            || |..:.|.....:.:.|.|    |.||....|.|:|::|....|...|.:||           
Mouse    60 RP-VQAWVESLRGFEQERIGLAELHPDVFATAPRLDIVHQVAIWQRNFRRISYANTKTRAELLNI 123

  Fly    57 ---------VSELAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTFR 112
                     .|:....|||.:   |..:.|.:|  .||..|            |.|  .||..: 
Mouse   124 THSNTLCQPSSKFLRSQTSGD---TNTSYATVP--AGGVAH------------GPR--GPTSYY- 168

  Fly   113 RWHRKVNVNQRRYALVSAIAASGVPA-----LVQSKGHVIDGVSEFP 154
                        |.|...:.|.|:..     |:|...|::|.: |.|
Mouse   169 ------------YMLPMKVRALGLKVALTVKLMQDDLHIVDSL-ELP 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL4NP_524538.2 PTZ00428 6..383 CDD:185611 41/177 (23%)
Ribosomal_L4 10..268 CDD:294231 39/174 (22%)
Ribos_L4_asso_C 278..350 CDD:291072
Mrpl4NP_001344828.1 Ribosomal_L4 81..278 CDD:306944 35/155 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0088
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.