DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL4 and RPS16

DIOPT Version :9

Sequence 1:NP_524538.2 Gene:RpL4 / 43349 FlyBaseID:FBgn0003279 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001350789.1 Gene:RPS16 / 6217 HGNCID:10396 Length:152 Species:Homo sapiens


Alignment Length:32 Identity:9/32 - (28%)
Similarity:16/32 - (50%) Gaps:8/32 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 LKLAPGGHVGRFVIWTESAFARLNDLFGTWKK 272
            :::..||||.:  |:.||      ...|.|::
Human    70 VRVKGGGHVAQ--IYGES------QELGAWRR 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL4NP_524538.2 PTZ00428 6..383 CDD:185611 9/32 (28%)
Ribosomal_L4 10..268 CDD:294231 7/26 (27%)
Ribos_L4_asso_C 278..350 CDD:291072
RPS16NP_001350789.1 Ribosomal_S9 6..>86 CDD:320913 7/23 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0088
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.