powered by:
Protein Alignment RpL4 and RPS16
DIOPT Version :9
Sequence 1: | NP_524538.2 |
Gene: | RpL4 / 43349 |
FlyBaseID: | FBgn0003279 |
Length: | 401 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001350789.1 |
Gene: | RPS16 / 6217 |
HGNCID: | 10396 |
Length: | 152 |
Species: | Homo sapiens |
Alignment Length: | 32 |
Identity: | 9/32 - (28%) |
Similarity: | 16/32 - (50%) |
Gaps: | 8/32 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 241 LKLAPGGHVGRFVIWTESAFARLNDLFGTWKK 272
:::..||||.: |:.|| ...|.|::
Human 70 VRVKGGGHVAQ--IYGES------QELGAWRR 93
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0088 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.