DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL4 and mRpL4

DIOPT Version :9

Sequence 1:NP_524538.2 Gene:RpL4 / 43349 FlyBaseID:FBgn0003279 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_524939.1 Gene:mRpL4 / 49425 FlyBaseID:FBgn0001995 Length:296 Species:Drosophila melanogaster


Alignment Length:160 Identity:41/160 - (25%)
Similarity:65/160 - (40%) Gaps:32/160 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLGNARPLVSVYTEKNEPAKDKNICL----PAVFKAPIRPDVVNEVHQLLRRNNRQAYAVSELA 61
            :|...||   ..:.|..:...::.:.|    |.||.|..|.|::.|..:.     :..|....:|
  Fly    59 VSRNTAR---QAWIENTDAVAERKVGLIELHPDVFAAQPRVDIIQENVEW-----QSKYRYVSMA 115

  Fly    62 GHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMF----APTKTFRR--WHRKVNV 120
            ..:|.||..|.||  ...|: :|||..|.| .....|.:||.:.    :||..|..  ::::|  
  Fly   116 HTKTRAEVRGGGR--KPWPQ-KGGGRARHG-SLRSPMLKGGGVVHGPRSPTTHFYMLPFYKRV-- 174

  Fly   121 NQRRYALVSAIAASGVPALVQSKGHVIDGV 150
                ..|.|.::..    |.|...|:||.|
  Fly   175 ----LGLTSTLSVK----LAQDDLHIIDNV 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL4NP_524538.2 PTZ00428 6..383 CDD:185611 40/155 (26%)
Ribosomal_L4 10..268 CDD:294231 38/151 (25%)
Ribos_L4_asso_C 278..350 CDD:291072
mRpL4NP_524939.1 Ribosomal_L4 83..274 CDD:278970 36/133 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0088
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.