DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL4 and RpL4

DIOPT Version :10

Sequence 1:NP_524538.2 Gene:RpL4 / 43349 FlyBaseID:FBgn0003279 Length:401 Species:Drosophila melanogaster
Sequence 2:XP_312665.4 Gene:RpL4 / 1273663 VectorBaseID:AGAMI1_001853 Length:435 Species:Anopheles gambiae


Alignment Length:96 Identity:18/96 - (18%)
Similarity:38/96 - (39%) Gaps:17/96 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 KKQVTVIDKDHAKEYKRCRAELKKRSSDTLRLQKKAKK-----GAADNLHVLVESSMQDVTMR-R 179
            :|.:|..||         :.:.|::.|..:.:.|..|:     |.:.....::.|.:.|:..| .
Mosquito    17 QKNITKTDK---------KKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIA 72

  Fly   180 CELEEVERKSLRAIMVEERTRYCTFVNMLQP 210
            .|...:...:.|:.:.....:  |.|.:|.|
Mosquito    73 AEASRLAHYNKRSTITSREIQ--TAVRLLLP 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL4NP_524538.2 PTZ00428 6..383 CDD:185611 18/96 (19%)
RpL4XP_312665.4 PTZ00428 4..402 CDD:185611 18/96 (19%)

Return to query results.
Submit another query.