DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BCAS2 and MOS4

DIOPT Version :9

Sequence 1:NP_651596.1 Gene:BCAS2 / 43348 FlyBaseID:FBgn0039558 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_566599.1 Gene:MOS4 / 821343 AraportID:AT3G18165 Length:253 Species:Arabidopsis thaliana


Alignment Length:212 Identity:69/212 - (32%)
Similarity:110/212 - (51%) Gaps:11/212 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AGEVIVDALPYIDHGYDDVGVRESALAMVEEECRR--YRPTKNYLDHLPLPASSPFETPLMANEF 64
            |...::|||||||..|.:..::.....:||||.||  .:|.....|..|||.......|::..|:
plant    25 ANAEVIDALPYIDDDYGNPLIKSEVDRLVEEEMRRSSKKPADFLKDLPPLPKFDFKNCPVLGKEY 89

  Fly    65 ERIQNRLPMETLSMK-RYELPPPPSGKLSEVSAWQEAIENSMAQLEHQWVRSLNLELMLDYGTEA 128
            ||::...|...:..: ||:|..||:.|.::.:||::.::.:...|:.:.:...|||||...|.|.
plant    90 ERVRAGKPPVRIDFESRYKLEMPPANKRNDDAAWKQYLQKNQRSLQQKLIELENLELMSKLGPEL 154

  Fly   129 WKS---YLEVF-TAMQAKAQLQLQQLKKDIQDVNWQRKQAQTQAGERLRSLEAHWVLLVSKNYEI 189
            |:.   .|||| |.||..||.|.::::|    ||.:||..|......|.:|...|..|..||.||
plant   155 WRQNNHRLEVFLTRMQRLAQEQNEEIEK----VNRERKYHQQTTSYELNALSQEWRQLCVKNMEI 215

  Fly   190 ETECVELEKIVHAARQQ 206
            ::.|..||..:.:.:::
plant   216 QSACAMLETQIDSFKKE 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BCAS2NP_651596.1 BCAS2 6..208 CDD:283380 68/208 (33%)
MOS4NP_566599.1 BCAS2 28..234 CDD:399014 68/209 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 105 1.000 Domainoid score I2205
eggNOG 1 0.900 - - E1_KOG3096
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4291
Inparanoid 1 1.050 105 1.000 Inparanoid score I2116
OMA 1 1.010 - - QHG54679
OrthoDB 1 1.010 - - D1607056at2759
OrthoFinder 1 1.000 - - FOG0006523
OrthoInspector 1 1.000 - - oto2871
orthoMCL 1 0.900 - - OOG6_103435
Panther 1 1.100 - - LDO PTHR13296
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.