DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BCAS2 and Bcas2

DIOPT Version :9

Sequence 1:NP_651596.1 Gene:BCAS2 / 43348 FlyBaseID:FBgn0039558 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_080878.2 Gene:Bcas2 / 68183 MGIID:1915433 Length:225 Species:Mus musculus


Alignment Length:206 Identity:123/206 - (59%)
Similarity:151/206 - (73%) Gaps:0/206 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAGEVIVDALPYIDHGYDDVGVRESALAMVEEECRRYRPTKNYLDHLPLPASSPFETPLMANEFE 65
            :||||:||||||.|.||:..||||:|.|:||||.||||||||||.:|..|..|.|||.:|.||||
Mouse     7 VAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFE 71

  Fly    66 RIQNRLPMETLSMKRYELPPPPSGKLSEVSAWQEAIENSMAQLEHQWVRSLNLELMLDYGTEAWK 130
            |:..|.|:|.|||||||||.|.||:.::::||||.:.|||||||||.||..|||||..:|..|||
Mouse    72 RLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWK 136

  Fly   131 SYLEVFTAMQAKAQLQLQQLKKDIQDVNWQRKQAQTQAGERLRSLEAHWVLLVSKNYEIETECVE 195
            .|.|....|...||.:||:|:|.|||:|||||..|..||.:||.:|::||.|||||||||...|:
Mouse   137 VYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQ 201

  Fly   196 LEKIVHAARQQ 206
            ||..::..:||
Mouse   202 LENEIYQIKQQ 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BCAS2NP_651596.1 BCAS2 6..208 CDD:283380 119/201 (59%)
Bcas2NP_080878.2 BCAS2 11..214 CDD:399014 120/202 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850877
Domainoid 1 1.000 240 1.000 Domainoid score I2257
eggNOG 1 0.900 - - E1_KOG3096
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4291
Inparanoid 1 1.050 248 1.000 Inparanoid score I3237
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54679
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006523
OrthoInspector 1 1.000 - - oto91928
orthoMCL 1 0.900 - - OOG6_103435
Panther 1 1.100 - - LDO PTHR13296
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5336
SonicParanoid 1 1.000 - - X5498
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.