DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BCAS2 and bcas2

DIOPT Version :9

Sequence 1:NP_651596.1 Gene:BCAS2 / 43348 FlyBaseID:FBgn0039558 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_988924.1 Gene:bcas2 / 394520 XenbaseID:XB-GENE-959514 Length:223 Species:Xenopus tropicalis


Alignment Length:206 Identity:123/206 - (59%)
Similarity:152/206 - (73%) Gaps:0/206 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAGEVIVDALPYIDHGYDDVGVRESALAMVEEECRRYRPTKNYLDHLPLPASSPFETPLMANEFE 65
            :||:|:||||||.|.|||..||||:|.|:||||.||||||||||.:||.|..|.|||.:|.||||
 Frog     7 VAGDVVVDALPYFDQGYDAQGVREAAAALVEEETRRYRPTKNYLSYLPTPDYSAFETEIMRNEFE 71

  Fly    66 RIQNRLPMETLSMKRYELPPPPSGKLSEVSAWQEAIENSMAQLEHQWVRSLNLELMLDYGTEAWK 130
            |:.:|.|:|.|||||||||.|.||:.::::||||.:.|||||||||.||..|||||..:|..|||
 Frog    72 RLSSRQPLELLSMKRYELPAPLSGQRNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWK 136

  Fly   131 SYLEVFTAMQAKAQLQLQQLKKDIQDVNWQRKQAQTQAGERLRSLEAHWVLLVSKNYEIETECVE 195
            .|.|....|...||..||:|:|.|||:|||||.:|..||.|||.:|:.||.|||||||||...|:
 Frog   137 VYNENLLHMIDCAQKDLQKLRKKIQDLNWQRKNSQLTAGARLREMESTWVSLVSKNYEIERAIVQ 201

  Fly   196 LEKIVHAARQQ 206
            :|..|:..:::
 Frog   202 MENEVYQLKER 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BCAS2NP_651596.1 BCAS2 6..208 CDD:283380 120/201 (60%)
bcas2NP_988924.1 BCAS2 11..212 CDD:368566 121/200 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 241 1.000 Domainoid score I2207
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4291
Inparanoid 1 1.050 247 1.000 Inparanoid score I3196
OMA 1 1.010 - - QHG54679
OrthoDB 1 1.010 - - D1607056at2759
OrthoFinder 1 1.000 - - FOG0006523
OrthoInspector 1 1.000 - - oto102241
Panther 1 1.100 - - LDO PTHR13296
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5336
SonicParanoid 1 1.000 - - X5498
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.