DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BCAS2 and cwf7

DIOPT Version :9

Sequence 1:NP_651596.1 Gene:BCAS2 / 43348 FlyBaseID:FBgn0039558 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_595665.1 Gene:cwf7 / 2540585 PomBaseID:SPBC28F2.04c Length:187 Species:Schizosaccharomyces pombe


Alignment Length:204 Identity:48/204 - (23%)
Similarity:86/204 - (42%) Gaps:41/204 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAGEVIVDALPYIDHGYDDVGVRESALAMVEEECRR--------YRPTKNYLDHLPLPASSPFET 57
            |:..:.:|:|||.:..|::.. |.:|..:||||.:|        ....|.:..|           
pombe     1 MSYNISLDSLPYFESTYNEED-RSAAAQIVEEELKRSGGLLIKQEEQKKKFQSH----------- 53

  Fly    58 PLMANEFERIQNRL-------PMETLSMKRY-ELPPPPSGKLSEVSAWQEAIENSMAQLEHQWVR 114
                ...:|::|.:       .:..:.::|| :|.||.:         :|::..|....|:|..|
pombe    54 ----RLSDRLENAIVAAGKGEKLAAIDVQRYIQLKPPGT---------RESLLQSAVVWEYQKSR 105

  Fly   115 SLNLELMLDYGTEAWKSYLEVFTAMQAKAQLQLQQLKKDIQDVNWQRKQAQTQAGERLRSLEAHW 179
            :.||.|:..:|.:|:.|.||.........:.:|...||..|..|.:||..|.:.|.||...|..:
pombe   106 NDNLYLLEKHGEKAFDSSLEALEVQLELLEKELVNTKKLSQGCNRKRKHYQMEVGARLAEAEVKF 170

  Fly   180 VLLVSKNYE 188
            ..|:..:.:
pombe   171 GQLLQSSIQ 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BCAS2NP_651596.1 BCAS2 6..208 CDD:283380 47/199 (24%)
cwf7NP_595665.1 BCAS2 6..183 CDD:283380 47/199 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3096
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103435
Panther 1 1.100 - - LDO PTHR13296
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.770

Return to query results.
Submit another query.