DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BCAS2 and T12A2.21

DIOPT Version :9

Sequence 1:NP_651596.1 Gene:BCAS2 / 43348 FlyBaseID:FBgn0039558 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001366809.1 Gene:T12A2.21 / 188433 WormBaseID:WBGene00305999 Length:604 Species:Caenorhabditis elegans


Alignment Length:276 Identity:54/276 - (19%)
Similarity:89/276 - (32%) Gaps:127/276 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PLPASSPFETPLMANEFERIQNRLPMETLSMKRYELPPPPSGKLSEVSAWQEAIENSMAQLEHQW 112
            |..:|:||                     :.|:|.  .|...:..|.||      .::|.|..  
 Worm    28 PKKSSNPF---------------------ASKKYN--NPLHAEFDEPSA------EALADLNQ-- 61

  Fly   113 VRSLNL--------ELMLDYG---TEAWKSYL--------EVFTAMQAKAQLQLQQLK---KDIQ 155
            ::.||:        ||.|..|   |:...:.:        :||..:....:|..::||   ....
 Worm    62 IKDLNVLYFYIALDELYLTGGFAKTDTINNIILSQKSIPDDVFQLLITTLRLTRRELKNGDSSFT 126

  Fly   156 DVNWQRKQAQTQAGERLRSLEAHWVLLVSKNYEIETECVELEKIVHAARQQLRKITPPPSANDTA 220
            ::|.|.:.|:|:               ::||            :..|.::.||..|         
 Worm   127 ELNSQLEGAKTE---------------LTKN------------LFTAVKKALRNAT--------- 155

  Fly   221 PTPEYTNGFD-------------QNDLAESNGSSSSNPDPSQPGDDGTDADGD----------SK 262
               |.|:..|             :|||.:.|..|.          ||.:|..|          ||
 Worm   156 ---ETTDDQDSFIQRISELKLSTENDLDDLNARSG----------DGAEALADLLEGLKKKISSK 207

  Fly   263 E-EDKSEAQEES-SNG 276
            : |..|||...: |:|
 Worm   208 DFETISEATRNAFSSG 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BCAS2NP_651596.1 BCAS2 6..208 CDD:283380 31/181 (17%)
T12A2.21NP_001366809.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13296
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.