DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12259 and FAM50A

DIOPT Version :9

Sequence 1:NP_651595.1 Gene:CG12259 / 43347 FlyBaseID:FBgn0039557 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_004690.1 Gene:FAM50A / 9130 HGNCID:18786 Length:339 Species:Homo sapiens


Alignment Length:355 Identity:221/355 - (62%)
Similarity:286/355 - (80%) Gaps:19/355 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAHYKGAASEAGRAAQLMKKREIQQQEIEFRKKKI-EEELKLDKIENKFATHYDAVEQQLKSSTI 64
            ||.|||||||||||..||||||.|::::|..|::| ||.:....|:.||:.||||||.:|||||:
Human     1 MAQYKGAASEAGRAMHLMKKREKQREQMEQMKQRIAEENIMKSNIDKKFSAHYDAVEAELKSSTV 65

  Fly    65 GLVTLDEMKAKQEDIVREREKKLAQKKDEKDREKQRALEAIQAEKNKQ--KRQIQALSFNLDDDE 127
            |||||::||||||.:|:||||:||:|  |:.:|.|..||.::.::.|:  ||:|.:|||.|:::|
Human    66 GLVTLNDMKAKQEALVKEREKQLAKK--EQSKELQMKLEKLREKERKKEAKRKISSLSFTLEEEE 128

  Fly   128 EEEEEDDEDHDKKQLKIKQEDQPKPKWTEIKEDILPIKKKKICKNPDVDTSFLPDREREEQENRL 192
            |..||::|      ..:.:|        |::.:.:..||:|:.|||||||||||||:|||:||||
Human   129 EGGEEEEE------AAMYEE--------EMEREEITTKKRKLGKNPDVDTSFLPDRDREEEENRL 179

  Fly   193 REQLRQEWVMQQAELKDEDISITFSYWDGSGHRRNVLMKKGNSIYQFLQKCLELLRKEFIELKTV 257
            ||:|||||..:|.::|.|:|.|||||||||||||.|.|:|||::.|||||.||:|||:|.||::.
Human   180 REELRQEWEAKQEKIKSEEIEITFSYWDGSGHRRTVKMRKGNTMQQFLQKALEILRKDFSELRSA 244

  Fly   258 MADQLMYVKEDLILPHHYSFYDFIVTKARGKSGPLFQFDVHDDVRMISDASVEKEESHAGKVLLR 322
            ..:||||:|||||:|||:||||||||||||||||||.||||||||::|||:|||:|||||||:||
Human   245 GVEQLMYIKEDLIIPHHHSFYDFIVTKARGKSGPLFNFDVHDDVRLLSDATVEKDESHAGKVVLR 309

  Fly   323 SWYERNKHIFPASRWEPYDPTKSYDKYTIK 352
            ||||:|||||||||||||||.|.:|||||:
Human   310 SWYEKNKHIFPASRWEPYDPEKKWDKYTIR 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12259NP_651595.1 XAP5 110..351 CDD:282738 156/242 (64%)
FAM50ANP_004690.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 21/29 (72%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..177 29/69 (42%)
XAP5 <152..338 CDD:398536 141/185 (76%)
Nuclear localization signal. /evidence=ECO:0000255 152..155 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 330 1.000 Domainoid score I1150
eggNOG 1 0.900 - - E1_KOG2894
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3448
Inparanoid 1 1.050 444 1.000 Inparanoid score I1654
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55025
OrthoDB 1 1.010 - - D1061864at2759
OrthoFinder 1 1.000 - - FOG0003077
OrthoInspector 1 1.000 - - otm41519
orthoMCL 1 0.900 - - OOG6_102806
Panther 1 1.100 - - LDO PTHR12722
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R430
SonicParanoid 1 1.000 - - X2051
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.870

Return to query results.
Submit another query.