DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS22 and Mrps22

DIOPT Version :9

Sequence 1:NP_524537.1 Gene:mRpS22 / 43345 FlyBaseID:FBgn0039555 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001070998.1 Gene:Mrps22 / 683519 RGDID:1585674 Length:359 Species:Rattus norvegicus


Alignment Length:352 Identity:104/352 - (29%)
Similarity:178/352 - (50%) Gaps:54/352 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PTKPAALQYERD----PQPLFTDAETQRLLQSMTQLNLDKVYRKRTVPDNSSETKFMSNEQLDNE 87
            |.:|.:.:.|..    .:|.|.|.|.|.:|..||.|:|.|.::....|......|.|:..||: |
  Rat    49 PRRPFSSEAESGSSEVKKPTFMDEEVQSILTKMTGLDLQKTFKPAVQPLKPPTYKLMTQAQLE-E 112

  Fly    88 FQNLVVRAQQI-LQMPPIVQIKKDVERVIAKDTALKDFANSKFVFTDITFGRRQSERKVIVRDMD 151
            ...|.|.|.:| |:|||:::.:|.:..|:|:|..|:....:|:|||||::.....||.::||:..
  Rat   113 ATRLAVEAAKIRLKMPPVLEERKPINDVLAEDKILEGTETNKYVFTDISYNIPHRERFIVVREPS 177

  Fly   152 GTLAYATLDTTKRMNQLYFPLEGRQSYTPRMFALEELLAKCLAEHKYEFILDRLLVQYEPHEPEF 216
            |||..|:.:...|:.|:|||.|||:...|.:|. :|.|....::.::..:|:..:.|:||...|:
  Rat   178 GTLRKASWEERDRVIQIYFPKEGRRVLPPVIFK-DENLKTMYSQDRHADVLNLCVAQFEPDSTEY 241

  Fly   217 HNISARVFEHLNESKEFDLLRSTRHFGPMAFFYAWHRCIDDLLYDMIRRDYLHNAVELIALSYKL 281
            ..:..:.:|.::...::::||||||||.||::...::.||.||.|.|:||.:.:|..|:.|.:.|
  Rat   242 IKVHHQTYEDIDRHGKYEILRSTRHFGGMAWYLVNNKKIDGLLIDQIQRDLVDDATSLVQLYHML 306

  Fly   282 HNIPVEYQATLTELGKLHATPAESALAELRSVFRRHDNKQNIEQEIHTAIGKTEHDFAADEISLK 346
            |                   |...:..|.:            ||             ||:.::| 
  Rat   307 H-------------------PEGQSAQEAK------------EQ-------------AAEGVNL- 326

  Fly   347 FIEQYIASEHALKKVQLELAVQTLKEV 373
             |:.:..:| |.:...:|||:||.:|:
  Rat   327 -IKVFAKTE-AQRGAYIELALQTYQEI 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS22NP_524537.1 MRP-S22 41..282 CDD:287247 83/241 (34%)
Mrps22NP_001070998.1 MRP-S22 67..307 CDD:287247 83/241 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338205
Domainoid 1 1.000 153 1.000 Domainoid score I4203
eggNOG 1 0.900 - - E1_KOG3890
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H57030
Inparanoid 1 1.050 154 1.000 Inparanoid score I4238
OMA 1 1.010 - - QHG48815
OrthoDB 1 1.010 - - D363634at33208
OrthoFinder 1 1.000 - - FOG0007406
OrthoInspector 1 1.000 - - oto96181
orthoMCL 1 0.900 - - OOG6_107905
Panther 1 1.100 - - LDO PTHR13071
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5531
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.810

Return to query results.
Submit another query.