DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS22 and Mrps22

DIOPT Version :9

Sequence 1:NP_524537.1 Gene:mRpS22 / 43345 FlyBaseID:FBgn0039555 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_079761.1 Gene:Mrps22 / 64655 MGIID:1928137 Length:359 Species:Mus musculus


Alignment Length:335 Identity:102/335 - (30%)
Similarity:172/335 - (51%) Gaps:50/335 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 QPLFTDAETQRLLQSMTQLNLDKVYRKRTVPDNSSETKFMSNEQLDNEFQNLVVRAQQI-LQMPP 103
            :|.|.|.|.||:|..:|.|:|.|.:|....|......|.|:..||: |...|.|.|.:: |:|||
Mouse    66 KPAFMDEEVQRILTKITGLDLQKTFRPAIQPLKPPTYKLMTQAQLE-EATRLAVEAAKVRLKMPP 129

  Fly   104 IVQIKKDVERVIAKDTALKDFANSKFVFTDITFGRRQSERKVIVRDMDGTLAYATLDTTKRMNQL 168
            :::.:|.:..|:|:|..|:....:|:|||||::.....||.::||:..|||..|:.:...|:.|:
Mouse   130 VLEERKPINDVLAEDKILEGTETNKYVFTDISYNIPHRERFIVVREPSGTLRKASWEERDRVIQI 194

  Fly   169 YFPLEGRQSYTPRMFALEELLAKCLAEHKYEFILDRLLVQYEPHEPEFHNISARVFEHLNESKEF 233
            |||.|||:...|.:|. :|.|....::.::..:|:..:.|:||...|:..:..:.:|.::...::
Mouse   195 YFPKEGRRVLPPVIFK-DENLKTMYSQDRHADVLNLCVAQFEPDSAEYIKVHHQTYEDIDRHGKY 258

  Fly   234 DLLRSTRHFGPMAFFYAWHRCIDDLLYDMIRRDYLHNAVELIALSYKLHNIPVEYQATLTELGKL 298
            :|||||||||.||:::...:.||.||.|.|:||.:.:|..|:.|.:.||                
Mouse   259 ELLRSTRHFGGMAWYFVNKKKIDGLLIDQIQRDLVDDATSLVQLYHMLH---------------- 307

  Fly   299 HATPAESALAELRSVFRRHDNKQNIEQEIHTAIGKTEHDFAADEISLKFIEQYIASEHALKKVQL 363
               |...:..|.:            ||             ||:.:.|  |:.:..:| |.:...:
Mouse   308 ---PDGQSAQEAK------------EQ-------------AAEGVDL--IKVFAKTE-AQRGAYI 341

  Fly   364 ELAVQTLKEV 373
            |||:||.:|:
Mouse   342 ELALQTYQEI 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS22NP_524537.1 MRP-S22 41..282 CDD:287247 84/241 (35%)
Mrps22NP_079761.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..65
MRP-S22 67..307 CDD:287247 84/241 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834625
Domainoid 1 1.000 157 1.000 Domainoid score I4163
eggNOG 1 0.900 - - E1_KOG3890
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H57030
Inparanoid 1 1.050 157 1.000 Inparanoid score I4267
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48815
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007406
OrthoInspector 1 1.000 - - oto92620
orthoMCL 1 0.900 - - OOG6_107905
Panther 1 1.100 - - LDO PTHR13071
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4394
SonicParanoid 1 1.000 - - X5531
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.