DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS22 and mrps22

DIOPT Version :9

Sequence 1:NP_524537.1 Gene:mRpS22 / 43345 FlyBaseID:FBgn0039555 Length:393 Species:Drosophila melanogaster
Sequence 2:XP_002933390.2 Gene:mrps22 / 100485976 XenbaseID:XB-GENE-1000283 Length:326 Species:Xenopus tropicalis


Alignment Length:337 Identity:110/337 - (32%)
Similarity:173/337 - (51%) Gaps:60/337 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PLFTDAETQRLLQSMTQLNLDKVY---RKRTVPDNSSETKFMSNEQLDNEFQNLVVRAQQILQMP 102
            |.|||.|.|.||:.||.|||:||:   :::..|.:   .|.::.||.....|...:.|::.|:||
 Frog    37 PQFTDPEVQSLLKKMTGLNLEKVFPPIKQKLKPPS---YKLLTEEQYQETVQKAALAAEKCLKMP 98

  Fly   103 PIVQIKKDVERVIAKDTALKDFANSKFVFTDITFGRRQSERKVIVRDMDGTLAYATLDTTKRMNQ 167
            |::..:|.::.::|:||.|.|...:|:||||||:.....||.::||:.:|.|..||.:...||.|
 Frog    99 PVLNERKPIDSILAEDTILCDVETAKYVFTDITYSTPHRERFIVVREPNGVLRKATWEERDRMIQ 163

  Fly   168 LYFPLEGRQSYTPRMFALE--ELLAKCLAEHKYEFILDRLLVQYEPHEPEFHNISARVFEHLNES 230
            :|||.|||:...|.:|..|  ::|.|   :.::|.:|:|.|||::|...|:..:....:|.:...
 Frog   164 VYFPHEGRKLVPPPVFQAENMQILFK---QDRHEELLNRCLVQFDPDSAEYIRVHHHTYEDVELH 225

  Fly   231 KEFDLLRSTRHFGPMAFFYAWHRCIDDLLYDMIRRDYLHNAVELIALSYKLHNIPVEYQATLTEL 295
            .::||||||||||.||::....:.||.||.|||:||.|.:|:.|:.|.:.||             
 Frog   226 GKYDLLRSTRHFGGMAWYLCCRKKIDGLLIDMIQRDMLDDAINLVRLYHMLH------------- 277

  Fly   296 GKLHATPAESALAELRSVFRRHDNKQNIEQEIHTAIGKTEHDFAADEISLKFIEQYIASEHALKK 360
                  |......|.|                           .||.:.|  |:.|:..| :.|.
 Frog   278 ------PDSECAKESR---------------------------GADGVEL--IKIYVKME-SQKP 306

  Fly   361 VQLELAVQTLKE 372
            ..:|||:|..::
 Frog   307 RYIELALQAYQQ 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS22NP_524537.1 MRP-S22 41..282 CDD:287247 94/245 (38%)
mrps22XP_002933390.2 MRP-S22 39..278 CDD:402036 95/263 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 176 1.000 Domainoid score I3570
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H57030
Inparanoid 1 1.050 176 1.000 Inparanoid score I3936
OMA 1 1.010 - - QHG48815
OrthoDB 1 1.010 - - D363634at33208
OrthoFinder 1 1.000 - - FOG0007406
OrthoInspector 1 1.000 - - oto102917
Panther 1 1.100 - - LDO PTHR13071
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4394
SonicParanoid 1 1.000 - - X5531
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.