DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and FBXL20

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_001357137.1 Gene:FBXL20 / 84961 HGNCID:24679 Length:473 Species:Homo sapiens


Alignment Length:432 Identity:90/432 - (20%)
Similarity:141/432 - (32%) Gaps:149/432 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 ELLFEIFQYLDTSSILAVMHCSPRFENLLLDHRFYHHIDLSNGPLPMGILEEILGRATEKTHTIK 139
            |||..||.:||..::......|..:..|.||...:..|||      .....:|.||..|  :..|
Human    68 ELLLRIFSFLDVVTLCRCAQVSRAWNVLALDGSNWQRIDL------FDFQRDIEGRVVE--NISK 124

  Fly   140 ICG----PPSSQHVAG----EFRQFTQTLSSVFPRVVQLKVLELEGV--SLDFEYIHITEFPATL 194
            .||    ..|.:...|    ..|.|.|...::       :||.|.|.  :.|.....:::|.:.|
Human   125 RCGGFLRKLSLRGCLGVGDNALRTFAQNCRNI-------EVLNLNGCTKTTDATCTSLSKFCSKL 182

  Fly   195 RRLKLKDCSVRVGDTPKSIFYSIELHLLDLEDLSIEDNSWFEPYYIMGLSKL----PSLRRLSLK 255
            |.|.|..|:.....:.|::.....|    ||.|:|   ||.:.....|:..|    ..|:.|.||
Human   183 RHLDLASCTSITNMSLKALSEGCPL----LEQLNI---SWCDQVTKDGIQALVRGCGGLKALFLK 240

  Fly   256 GC-----------------------QALCKFVPYGSMAARFGFQKLESLDLRQTPINNSDLQCFS 297
            ||                       |...:....|.:....|..||:||             |.|
Human   241 GCTQLEDEALKYIGAHCPELVTLNLQTCLQITDEGLITICRGCHKLQSL-------------CAS 292

  Fly   298 AIENLKELLLES-----PQILHSKQAVAKKNTNGNATDEAAS----------------------- 334
            ...|:.:.:|.:     |::...:.|...:.|:...|..|.:                       
Human   293 GCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNCHELEKMDLEECVQITDSTLIQL 357

  Fly   335 ----PQ--------------------------PDSLKVLS-DDEPSTSRAAMEHLRACK--VAFN 366
                |:                          .|.|:|:. |:.|..:.|::|||::|.  ....
Human   358 SIHCPRLQVLSLSHCELITDDGIRHLGNGACAHDQLEVIELDNCPLITDASLEHLKSCHSLERIE 422

  Fly   367 LDNC-----SDRKEEKSPVP-----------TEPPSEGQDLQ 392
            |.:|     :..|..::.:|           |.|||.|...|
Human   423 LYDCQQITRAGIKRLRTHLPNIKVHAYFAPVTPPPSVGGSRQ 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040 12/38 (32%)
leucine-rich repeat 610..635 CDD:275381
FBXL20NP_001357137.1 F-box-like 64..106 CDD:338561 11/37 (30%)
leucine-rich repeat 102..129 CDD:275381 10/34 (29%)
AMN1 130..326 CDD:355707 46/222 (21%)
leucine-rich repeat 130..149 CDD:275381 3/18 (17%)
leucine-rich repeat 156..181 CDD:275381 6/31 (19%)
leucine-rich repeat 182..207 CDD:275381 6/24 (25%)
leucine-rich repeat 208..233 CDD:275381 8/27 (30%)
leucine-rich repeat 234..259 CDD:275381 6/24 (25%)
AMN1 257..431 CDD:355707 29/186 (16%)
leucine-rich repeat 260..285 CDD:275381 3/24 (13%)
leucine-rich repeat 286..311 CDD:275381 7/37 (19%)
leucine-rich repeat 312..337 CDD:275381 4/24 (17%)
leucine-rich repeat 338..363 CDD:275381 0/24 (0%)
leucine-rich repeat 364..392 CDD:275381 0/27 (0%)
leucine-rich repeat 393..417 CDD:275381 9/23 (39%)
leucine-rich repeat 418..443 CDD:275381 3/24 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153045
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1046098at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.