Sequence 1: | NP_651593.1 | Gene: | CG5003 / 43344 | FlyBaseID: | FBgn0039554 | Length: | 713 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_565242.1 | Gene: | AT1G80630 / 844402 | AraportID: | AT1G80630 | Length: | 578 | Species: | Arabidopsis thaliana |
Alignment Length: | 335 | Identity: | 69/335 - (20%) |
---|---|---|---|
Similarity: | 126/335 - (37%) | Gaps: | 102/335 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 61 LDRETECNLMDFCDELLFEIFQYLDTSSILAVMHCSPRFENLLLDHRFYHHIDLSNGPLPMGILE 125
Fly 126 EILGRATEKTHTIKICGPPSSQHVAGEFRQFTQTLSSVFPRVVQLKVLELEGVSLDFEYIHITE- 189
Fly 190 --FP-ATLRRLKLKDC----------SVRVG---------------DTPKSIFYS--IEL--HLL 222
Fly 223 DLEDLSIEDNSWFEPYYIMGLSK-LPSLRRLSLKGCQAL---C-KFVPYGS-------------- 268
Fly 269 -----MAARFGFQK-LESLDLRQTPINNSDLQCF--SAIENLKELLLESPQ---------ILHSK 316
Fly 317 QAVAKKNTNG 326 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5003 | NP_651593.1 | F-box | 68..114 | CDD:279040 | 5/45 (11%) |
leucine-rich repeat | 610..635 | CDD:275381 | |||
AT1G80630 | NP_565242.1 | leucine-rich repeat | 64..108 | CDD:275381 | 14/61 (23%) |
leucine-rich repeat | 109..134 | CDD:275381 | 4/24 (17%) | ||
AMN1 | 121..335 | CDD:187754 | 42/183 (23%) | ||
leucine-rich repeat | 135..159 | CDD:275381 | 4/23 (17%) | ||
leucine-rich repeat | 165..190 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 191..216 | CDD:275381 | 8/24 (33%) | ||
leucine-rich repeat | 244..268 | CDD:275381 | 9/24 (38%) | ||
leucine-rich repeat | 269..294 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 295..320 | CDD:275381 | 2/8 (25%) | ||
leucine-rich repeat | 321..346 | CDD:275381 | |||
leucine-rich repeat | 347..398 | CDD:275381 | |||
AMN1 | <386..508 | CDD:187754 | |||
leucine-rich repeat | 399..424 | CDD:275381 | |||
leucine-rich repeat | 425..448 | CDD:275381 | |||
leucine-rich repeat | 449..473 | CDD:275381 | |||
leucine-rich repeat | 474..499 | CDD:275381 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1046098at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |