DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and SKP2B

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_001185415.1 Gene:SKP2B / 844036 AraportID:AT1G77000 Length:360 Species:Arabidopsis thaliana


Alignment Length:296 Identity:56/296 - (18%)
Similarity:104/296 - (35%) Gaps:103/296 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LPMGILEEILGRATEKTHTIKICGPPSSQHVAGEFR-----------------QFTQTLSSVFPR 166
            :|:.:|.:||....::|..|..|       :...:|                 .....:.|:.|:
plant    31 IPVELLMKILNLVDDRTVIIASC-------ICSGWRDAVSLGLTRLSLSWCKKNMNSLVLSLAPK 88

  Fly   167 VVQLKVLELEGVSLDFEYIHITEFPATLRRLK--LKDCSVRVGDTPKSIFYSIELHLLDLEDLSI 229
            .|:|:.|                   .||:.|  |:|.:|.          :|..|..:|:||.:
plant    89 FVKLQTL-------------------VLRQDKPQLEDNAVE----------AIANHCHELQDLDL 124

  Fly   230 EDNSWFEPYYIMGLSK-LPSLRRLSLKGCQA--------LCKFVPYGSMAARFGFQKLESLDLRQ 285
            ..:|....:.:..|:: ..:|.:|:|.||.:        |.:|.           :||:.|:|  
plant   125 SKSSKITDHSLYSLARGCTNLTKLNLSGCTSFSDTALAHLTRFC-----------RKLKILNL-- 176

  Fly   286 TPINNSDLQCFSAI-ENLKELLLESPQILHSKQAVAKKNTNGNATDEAASPQPD-------SLKV 342
                   ..|..|: :|..:.:.|:...|.|......:|.:.:.....|...||       |..:
plant   177 -------CGCVEAVSDNTLQAIGENCNQLQSLNLGWCENISDDGVMSLAYGCPDLRTLDLCSCVL 234

  Fly   343 LSDDEPSTSRAAMEHLRA-----CKVAFNLDNCSDR 373
            ::|:..........|||:     |:      |.:||
plant   235 ITDESVVALANRCIHLRSLGLYYCR------NITDR 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040
leucine-rich repeat 610..635 CDD:275381
SKP2BNP_001185415.1 F-box 28..63 CDD:395521 8/38 (21%)
leucine-rich repeat 66..91 CDD:275381 2/24 (8%)
leucine-rich repeat 92..118 CDD:275381 10/54 (19%)
AMN1 <115..264 CDD:187754 34/174 (20%)
leucine-rich repeat 119..144 CDD:275381 5/24 (21%)
leucine-rich repeat 145..170 CDD:275381 7/35 (20%)
leucine-rich repeat 171..197 CDD:275381 7/34 (21%)
leucine-rich repeat 198..223 CDD:275381 4/24 (17%)
leucine-rich repeat 224..249 CDD:275381 2/24 (8%)
leucine-rich repeat 250..272 CDD:275381 6/21 (29%)
leucine-rich repeat 294..319 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1046098at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.