DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and SKIP2

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_569047.1 Gene:SKIP2 / 836860 AraportID:AT5G67250 Length:527 Species:Arabidopsis thaliana


Alignment Length:321 Identity:59/321 - (18%)
Similarity:111/321 - (34%) Gaps:96/321 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 DFCDELLFEIFQYLDTSSILAVMHCSPRFENLLLDHRFYHHIDLSNGPLPMGILEEILGRATEKT 135
            |..||.|..:||:|.............|:  ||:|.:..|.:.|.                    
plant    45 DLPDECLAHVFQFLGAGDRKRCSLVCKRW--LLVDGQSRHRLSLD-------------------- 87

  Fly   136 HTIKICGPPSSQHVAGEFRQFTQTLSSVFPRVVQLKV-LELEGVSLDFEYIHITEFPA-TLRRLK 198
                         ...|...|..::.:.|..|.:|.: .:.:.|||..|.:.:..... .|.|:|
plant    88 -------------AKDEISSFLTSMFNRFDSVTKLALRCDRKSVSLSDEALAMISVRCLNLTRVK 139

  Fly   199 LKDCSVRVGDTPKSIFYSIELHLLDLEDLSIEDNSWFEPYYIMGLSKLPSLRRLSL-------KG 256
            |:.|.                   ::.||.:||.:          ....:|::||:       ||
plant   140 LRGCR-------------------EITDLGMEDFA----------KNCKNLKKLSVGSCNFGAKG 175

  Fly   257 CQAL---CKFVPYGSMAARFGFQKLESLDLRQTP--INNSDLQ--CFSAIEN--LKELLLESPQI 312
            ..|:   ||.:...|:....|..  |:.:|...|  .::|.|:  |...:.|  :.|.||.:.:.
plant   176 VNAMLEHCKLLEELSVKRLRGIH--EAAELIHLPDDASSSSLRSICLKELVNGQVFEPLLATTRT 238

  Fly   313 LHSKQAVAKKNTNGNATDEAASPQPDSLKVLSDDEPSTSRAAMEHLRACKVAFN-LDNCSD 372
            |.:.:.:           .........|:::::.:.|.|...:|.|:...:..: :..||:
plant   239 LKTLKII-----------RCLGDWDKVLQMIANGKSSLSEIHLERLQVSDIGLSAISKCSN 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040 12/42 (29%)
leucine-rich repeat 610..635 CDD:275381
SKIP2NP_569047.1 F-box-like 45..>73 CDD:403981 7/27 (26%)
AMN1 82..295 CDD:187754 48/282 (17%)
leucine-rich repeat 106..128 CDD:275381 6/21 (29%)
leucine-rich repeat 135..160 CDD:275381 9/53 (17%)
leucine-rich repeat 161..185 CDD:275381 7/23 (30%)
leucine-rich repeat 239..264 CDD:275381 2/35 (6%)
leucine-rich repeat 265..288 CDD:275381 4/22 (18%)
leucine-rich repeat 289..314 CDD:275381 59/321 (18%)
AMN1 <311..>416 CDD:187754
leucine-rich repeat 315..342 CDD:275381
leucine-rich repeat 343..367 CDD:275381
leucine-rich repeat 368..393 CDD:275381
leucine-rich repeat 394..418 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1046098at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.