DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and SKIP1

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_568870.1 Gene:SKIP1 / 835901 AraportID:AT5G57900 Length:300 Species:Arabidopsis thaliana


Alignment Length:244 Identity:56/244 - (22%)
Similarity:84/244 - (34%) Gaps:82/244 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 DELLFEIF-------QYLDTSSILAVMHCSPRFENLLLDHRFYHHIDLSNGPLP----MGILEEI 127
            |..|:.||       .|.:::.:     .||.||. .:|......:|.|.|.|.    ....:..
plant    45 DPYLWSIFDLEPWFDSYPESTHL-----WSPEFEQ-KVDLMLRSVVDWSEGGLTKIRVRHCSDHA 103

  Fly   128 LGRATEKTHTIKICGPPSSQHVAGEFRQFTQTLSSVFPRVVQLKVLELEGVSLDFEYIH------ 186
            |..|.::...:::....||.:|.      ..:::.:..|...||       .||..|.|      
plant   104 LSYAADRCPNLQVLAIRSSPNVT------DASMTKIAFRCRSLK-------ELDISYCHEISHDT 155

  Fly   187 ---ITEFPATLRRLK--LKDCSVR-VGDTPKSIF-----------YSIELHLLDLEDLSIEDNSW 234
               |......||.||  |.|.|.| :|..|....           .:|..|:::||.|.|:    
plant   156 LVMIGRNCPNLRILKRNLMDWSSRHIGSVPTEYLDACPQDGDTEADAIGKHMINLEHLEIQ---- 216

  Fly   235 FEPYYIMGLSKLPSLRRLSLKGCQALCKFVPYGSMAARFGFQKLESLDL 283
                          ..|||:||..::|:           |..|||.|||
plant   217 --------------FSRLSVKGLASICE-----------GCPKLEYLDL 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040 10/46 (22%)
leucine-rich repeat 610..635 CDD:275381
SKIP1NP_568870.1 AMN1 <89..>253 CDD:187754 44/194 (23%)
leucine-rich repeat 91..113 CDD:275381 3/21 (14%)
leucine-rich repeat 114..139 CDD:275381 4/30 (13%)
leucine-rich repeat 140..165 CDD:275381 7/31 (23%)
leucine-rich repeat 187..209 CDD:275381 2/21 (10%)
leucine-rich repeat 210..234 CDD:275381 11/52 (21%)
leucine-rich repeat 235..260 CDD:275381 5/6 (83%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1046098at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.