DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and AT5G23340

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_197725.1 Gene:AT5G23340 / 832398 AraportID:AT5G23340 Length:405 Species:Arabidopsis thaliana


Alignment Length:414 Identity:81/414 - (19%)
Similarity:148/414 - (35%) Gaps:125/414 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 EEILG---------RATEKTHTIKICGPPSSQHVAGEFRQ-----FTQTLS-SVFPRVVQLKVLE 174
            :|:.|         ::|::.......||...:.:|..|.|     .:|::| |.:|.|..   .:
plant    28 KEVFGLVCKRWLNLQSTDRKKLAARAGPHMLRRLASRFTQIVELDLSQSISRSFYPGVTD---SD 89

  Fly   175 LEGVSLDFEYIHITEFPATLRRLKLKDCSVRVGDTPKSIFYSIE--LHLLDLEDLS----IEDNS 233
            |..:|..|::         ||.|.|.:|. .:.||..:   ||.  |.||...|:|    :.|. 
plant    90 LAVISEGFKF---------LRVLNLHNCK-GITDTGLA---SIGRCLSLLQFLDVSYCRKLSDK- 140

  Fly   234 WFEPYYIMGLSKLP----SLRRLSLKGCQAL----------------------CKFVPYGSMAAR 272
                    |||.:.    .||.|.|.||:.:                      |..:....:|..
plant   141 --------GLSAVAEGCHDLRALHLAGCRFITDESLKSLSERCRDLEALGLQGCTNITDSGLADL 197

  Fly   273 F-GFQKLESLDLRQ------TPINNSDLQCFSAIENLKELLLESPQILH---SKQAVAKKNTNGN 327
            . |.:|::|||:.:      ..:::....|.|:::.||  ||:..::.:   |..|...||....
plant   198 VKGCRKIKSLDINKCSNVGDAGVSSVAKACASSLKTLK--LLDCYKVGNESISSLAQFCKNLETL 260

  Fly   328 ATDEAASPQPDSLKVLSDDEPSTSRAAMEHLRACKVAFNLDNCSDRKEEKSPVPTEPPSEGQDLQ 392
            ..........:|:.:|:|    :.:.::::||       :|.|.:..:.......:        |
plant   261 IIGGCRDISDESIMLLAD----SCKDSLKNLR-------MDWCLNISDSSLSCILK--------Q 306

  Fly   393 AKRIRAPSESDDEDTSSTSGSSSDKLEVLSLPRNGHSNAAPLS--------------GGVDLPPL 443
            .|.:.|......|:.:.|:.......:||.|.....||...::              ..:|:..|
plant   307 CKNLEALDIGCCEEVTDTAFRDLGSDDVLGLKVLKVSNCTKITVTGIGKLLDKCSSLEYIDVRSL 371

  Fly   444 PHAADAANAADAPIAVDAANIEAP 467
            ||..:        :....|.:|.|
plant   372 PHVTE--------VRCSEAGLEFP 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040
leucine-rich repeat 610..635 CDD:275381
AT5G23340NP_197725.1 F-box_5 12..48 CDD:408301 3/19 (16%)
leucine-rich repeat 68..99 CDD:275381 8/33 (24%)
AMN1 85..323 CDD:187754 56/283 (20%)
leucine-rich repeat 100..125 CDD:275381 10/28 (36%)
leucine-rich repeat 126..151 CDD:275381 7/33 (21%)
leucine-rich repeat 152..177 CDD:275381 6/24 (25%)
leucine-rich repeat 178..203 CDD:275381 3/24 (13%)
leucine-rich repeat 204..230 CDD:275381 4/25 (16%)
leucine-rich repeat 231..256 CDD:275381 6/26 (23%)
leucine-rich repeat 257..283 CDD:275381 3/29 (10%)
leucine-rich repeat 284..309 CDD:275381 5/39 (13%)
leucine-rich repeat 310..336 CDD:275381 4/25 (16%)
leucine-rich repeat 337..362 CDD:275381 3/24 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1046098at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.