DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and AT4G30640

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_567849.1 Gene:AT4G30640 / 829187 AraportID:AT4G30640 Length:301 Species:Arabidopsis thaliana


Alignment Length:254 Identity:51/254 - (20%)
Similarity:81/254 - (31%) Gaps:98/254 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 DTSSILAVMHCSPRFENLLLDHRFYHHIDLSNGPLPMGILEE---ILGRATEKTHTIKICGPPSS 146
            |.|.....|:| |....|.:.:.:             ||..|   .|||:.:....:|       
plant   139 DASMEKIAMNC-PNLRELDISYSY-------------GITHESLITLGRSCQNLKILK------- 182

  Fly   147 QHVAGEFRQFTQTLSSVFPRVVQLKVLELEGVSLDFEYIHITEFPATLRRLKLKDCSVRVGDTPK 211
                   |.....|....|.:|         ..||:    :..||             |.|:...
plant   183 -------RNLLPRLGPSLPTIV---------APLDY----LATFP-------------RYGNIEA 214

  Fly   212 SIFYSIELHLLDLEDLSIEDNSWFEPYYIMGLSKLPSLRRLSLKGCQALCKFVPYGSMAARFGFQ 276
            .|   |..::..|:.|.|..::                  |:.:|..::||           |..
plant   215 RI---IGKYMTQLKHLEIRYST------------------LTARGLDSVCK-----------GCS 247

  Fly   277 KLESLDLRQ-TPINNSDLQC-FSAIENLKELLLE--SPQILHSKQAVAKKNTNGNATDE 331
            .||.:|||. ..:..||:.. .|.::||.|::..  :|.|     ||.:....||..:|
plant   248 NLEYMDLRGCISLTRSDINTNTSGLKNLTEIIKPDFNPPI-----AVLRVPRPGNPREE 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040 6/28 (21%)
leucine-rich repeat 610..635 CDD:275381
AT4G30640NP_567849.1 AMN1 <101..>179 CDD:187754 12/53 (23%)
leucine-rich repeat 103..125 CDD:275381
leucine-rich repeat 126..151 CDD:275381 4/12 (33%)
leucine-rich repeat 152..177 CDD:275381 7/37 (19%)
leucine-rich repeat 178..223 CDD:275381 13/87 (15%)
leucine-rich repeat 224..248 CDD:275381 8/52 (15%)
leucine-rich repeat 249..274 CDD:275381 8/24 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1046098at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.